Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF894243DLU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q9VLE5 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Drosophila melanogaster (Fruit fly) |
| Sequence | MELKSMDPVEMPIFGSTLKLMKFWSYLFVHNWRRYVAMTPYIIINCTQYVDIYLSTESLD FIIRNVYLAVLFTNTVVRGVLLCVQRFSYERFINILKSFYIELLQSDDPIINILVKETTR LSVLISRINLLMGCCTCIGFVTYPIFGSERVLPYGMYLPTIDEYKYASPYYEIFFVIQAI MAPMGCCMYIPYTNMVVTFTLFAILMCRVLQHKLRSLEKLKNEQVRGEIIWCIKYQLKLS GFVDSMNALNTHLHLVEFLCFGAMLCVLLFSLIIAQTIAQTVIVIAYMVMIFANSVVLYY VANELYFQSFDIAIAAYESNWMDFDVDTQKTLKFLIMRSQKPLAILVGGTYPMNLKMLQS LLNAIYSFFTLLRRVYG |
| Source | in vitro E.coli expression system |
| Gene Names | Or30a |
| Protein Names | Recommended name: Putative odorant receptor 30a |
| Expression Region | 1-377 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. Involved in the behavioral responses to propyl acetate and anisole. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or30a subfamily |
| Database Links |
KEGG: dme:Dmel_CG13106 STRING: 7227.FBpp0079371 UniGene: Dm.26766 |
Or30a Antibodies for Drosophila melanogaster (Fruit fly)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA894243XA01DLU | OR30A Antibody | Drosophila melanogaster (Fruit fly) | ELISA, WB (ensure identification of antigen) |
Or30a Proteins for Drosophila melanogaster (Fruit fly)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP894243DLU1 CSB-EP894243DLU1 CSB-BP894243DLU1 CSB-MP894243DLU1 |
Recombinant Drosophila melanogaster Putative odorant receptor 30a(Or30a),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Mouse Plasminogen activator inhibitor 1(Serpine1)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human Guanine nucleotide-binding protein subunit alpha-15(GNA15)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Neuroendocrine convertase 2(Pcsk2)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Mouse Sulfotransferase 1A1(Sult1a1)
Express system: E.coli
Species: Mus musculus (Mouse)
