Recombinant Drosophila melanogaster Putative odorant receptor 45a(Or45a)

Code CSB-CF894646DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9V568
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MDASYFAVQRRALEIVGFDPSTPQLSLKHPIWAGILILSLISHNWPMVVYALQDLSDLTR LTDNFAVFMQGSQSTFKFLVMMAKRRRIGSLIHRLHKLNQAASATPNHLEKIERENQLDR YVARSFRNAAYGVICASAIAPMLLGLWGYVETGVFTPTTPMEFNFWLDERKPHFYWPIYV WGVLGVAAAAWLAIATDTLFSWLTHNVVIQFQLLELVLEEKDLNGGDSRLTGFVSRHRIA LDLAKELSSIFGEIVFVKYMLSYLQLCMLAFRFSRSGWSAQVPFRATFLVAIIIQLSSYC YGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPAKIFGFMFVVDLPLLL WVIRTAGSFLAMLRTFER
Source in vitro E.coli expression system
Gene Names Or45a
Protein Names Recommended name: Putative odorant receptor 45a
Expression Region 1-378
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. Involved in the behavioral responses to hexanol, pentyl acetate, benzyl acetate, and 2-heptanone.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or1a subfamily
Database Links

KEGG: dme:Dmel_CG1978

STRING: 7227.FBpp0087587

UniGene: Dm.27733

Related Products

Or45a Antibodies

Or45a Antibodies for Drosophila melanogaster (Fruit fly)

Or45a Proteins

Or45a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.