Recombinant Drosophila melanogaster Putative odorant receptor 65a(Or65a)

Code CSB-CF307305DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P82982
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MTELRSERKNGNWDRLFGPFFESWAVFKAPQAKSRHIIAYWTRDQLKALGFYMNSEQRRL PRIVAWQYFVSIQLATALASLFYGISESIGDIVNLGRDLVFIITIIFICFRLVFFAQYAG ELDVIIDALEDIYHWSIKGPATKEVQETKRLHFLLFMALIITWFSFLILFMLIKISTPFW IESQTLPFHVSWPFQLHDPSKHPIAYIIIFVSQSTTMLYFLIWLGVVENMGVSLFFELTS ALRVLCIELRNLQELCLGDEDMLYRELCRMTKFHQQIILLTDRCNHIFNGAFIMQMLINF LLVSLSLFEVLAAKKNPQVAVEYMIIMLMTLGHLSFWSKFGDMFSKESEQVALAVYEAYD PNVGSKSIHRQFCFFIQRAQKPLIMKASPFPPFNLENYMFILKQCYSILTILANTLE
Source in vitro E.coli expression system
Gene Names Or65a
Protein Names Recommended name: Putative odorant receptor 65a
Expression Region 1-417
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. Involved in olfactory communication for modulating aggression through the sensing of the male-specific pheromone 11-cis-vaccenyl acetate (cVA). Although acute exposure to cVA elicites aggression through Or67d olfactory receptor neurons (ORNs), chronic cVA exposure reduces aggression through Or65a ORNs. Moreover, cVA leads to generalized learning with mated females. It is a major component of the male cuticular hydrocarbon profile, but it is not found on virgin females. During copulation, cVA is transferred to the female in ejaculate along with sperm and peptides that decrease her sexual receptivity.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or49a subfamily
Tissue Specificity Expressed in olfactory sensory neurons in the antenna.
Database Links

KEGG: dme:Dmel_CG32401

STRING: 7227.FBpp0076712

UniGene: Dm.26516

Related Products

Or65a Antibodies

Or65a Antibodies for Drosophila melanogaster (Fruit fly)

Or65a Proteins

Or65a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.