Recombinant Drosophila melanogaster Putative odorant receptor 94b(Or94b)

Code CSB-CF893733DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9VCS8
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MESTNRLSAIQTLLVIQRWIGLLKWENEGEDGVLTWLKRIYPFVLHLPLTFTYIALMWYE AITSSDFEEAGQVLYMSITELALVTKLLNIWYRRHEAASLIHELQHDPAFNLRNSEEIKF WQQNQRNFKRIFYWYIWGSLFVAVMGYISVFFQEDYELPFGYYVPFEWRTRERYFYAWGY NVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNAAEEKARPELRRIFQLHT KVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQ IFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIG LPIFVKTINNAYSFFALLLKISK
Source in vitro E.coli expression system
Gene Names Or94b
Protein Names Recommended name: Putative odorant receptor 94b
Expression Region 1-383
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Database Links

KEGG: dme:Dmel_CG6679

STRING: 7227.FBpp0083735

UniGene: Dm.27603

Related Products

Or94b Antibodies

Or94b Antibodies for Drosophila melanogaster (Fruit fly)

Or94b Proteins

Or94b Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.