Recombinant Drosophila melanogaster Serine protease HTRA2, mitochondrial(HtrA2)

Code CSB-CF892839DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9VFJ3
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence SKMTGRRRDFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLIL TNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSVMRLGKSSTLRS GEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNL DGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEKRKKGSAYKTGYPVKRYMGITMLTLT PDILFELKSRSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYD ALADNSKTLDIVILRGVKQMHVTITPEDP
Source in vitro E.coli expression system
Gene Names HtrA2
Protein Names Recommended name: Serine protease HTRA2, mitochondrial EC= 3.4.21.108 Alternative name(s): High temperature requirement protein A2 Short name= DmHtrA2 Short name= HtrA2 Omi stress-regulated endoprotease Short name=
Expression Region 94-422
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Can antagonize antiapoptotic activity of th by directly inducing the degradation of th.
Subcellular Location Mitochondrion intermembrane space, Single-pass membrane protein, Mitochondrion membrane, Single-pass membrane protein
Protein Families Peptidase S1C family
Database Links

KEGG: dme:Dmel_CG8464

STRING: 7227.FBpp0303078

UniGene: Dm.5609

Pathway Apoptosis

Related Products

HtrA2 Antibodies

HtrA2 Antibodies for Drosophila melanogaster (Fruit fly)

HtrA2 Proteins

HtrA2 Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.