Recombinant Drosophila melanogaster Tafazzin homolog (Taz)

Code CSB-CF893713DLU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Taz
Uniprot No.
Alternative Names
Taz; CG8766; Tafazzin; TAZ; dTAZ
Species
Drosophila melanogaster (Fruit fly)
Expression Region
1-378
Target Protein Sequence
MFMVVCSNLRRPGHVGAASAARNINWLISEGYTPPIRAMARPYVQAPEARPVPDERYPGS QQDRKDIATQTVRSSKPKDLRPPSPPTPSQTLNSSSLPPPMSDQDADPSLDVPTGVAMPY NIDWIFPRLRNPSKFWYVVSQFVVSAVGIFSKVVLMFLNKPRVYNRERLIQLITKRPKGI PLVTVSNHYSCFDDPGLWGCLPLGIVCNTYKIRWSMAAHDICFTNKLHSLFFMFGKCIPV VRGIGVYQDAINLCIEKAALGHWIHVFPEGKVNMDKEELRLKWGVGRIIYESPKIPIILP MWHEGMDDLLPNVEPYVIQRGKQVTLNVGQPLDLNDFILDLKKRQVPEPTARKLITDKIQ EAFRDLRAETEKLHRERN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acyltransferase required to remodel newly synthesized phospholipid cardiolipin (1',3'-bis-[1,2-diacyl-sn-glycero-3-phospho]-glycerol or CL), a key component of the mitochondrial inner membrane, with tissue specific acyl chains necessary for adequate mitochondrial function. Remodeling of the acyl groups of CL in the mitochondrial inner membrane affects the assembly and stability of respiratory chain complex IV and its supercomplex forms. This makes CL critical for the coassembly of lipids and proteins in mitochondrial membranes. Catalyzes the transacylacion between phospholipids and lysophospholipids, with the highest rate being between phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) and CL. Catalyzes both 1-acyl-sn-glycero-3-phosphocholine (lysophosphatidylcholine or LPC) reacylation and PC-CL transacylation, that means, it exchanges acyl groups between CL and PC by a combination of forward and reverse transacylations. Also catalyzes transacylations between other phospholipids such as phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine or PE) and CL, between PC and PE, and between PC and phosphatidate (1,2-diacyl-sn-glycero-3-phosphate or PA), although at lower rate. Not regiospecific, it transfers acyl groups into any of the sn-1 and sn-2 positions of the monolysocardiolipin (MLCL), which is an important prerequisite for uniformity and symmetry in CL acyl distribution. Cannot transacylate dilysocardiolipin (DLCL), thus, the role of MLCL is limited to that of an acyl acceptor. CoA-independent, it can reshuffle molecular species within a single phospholipid class. Redistributes fatty acids between MLCL, CL, and other lipids, which prolongs the half-life of CL. Its action is completely reversible, which allows for cyclic changes, such as fission and fusion or bending and flattening of the membrane. Hence, by contributing to the flexibility of the lipid composition, it plays an important role in the dynamics of mitochondria membranes. Essential for the final stage of spermatogenesis, spermatid individualization. Required for the initiation of mitophagy.
Gene References into Functions
  1. propose that tafazzin reacts with non-bilayer-type lipid domains that occur in curved or hemifused membrane zones and that acyl specificity is driven by the packing properties of these domains PMID: 22941046
  2. Data show that tafazzin mutations in Drosophila generate a Barth-related phenotype, with the triad of abnormal cardiolipin, pathologic mitochondria, and motor weakness, suggesting causal links between these findings. PMID: 16855048
  3. Drosophila tafazzin is a CoA-independent, acyl-specific phospholipid transacylase with substrate preference for cardiolipin and phosphatidylcholine PMID: 17082194
  4. The data suggest that tafazzin deficiency affects cardiolipin in all mitochondria, but significant alterations of the ultrastructure, such as remodeling and aggregation of inner membranes, will only occur after specific differentiation. PMID: 19114128
  5. tafazzin deficiency in Drosophila disrupts the final stage of spermatogenesis, spermatid individualization, and causes male sterility PMID: 19164547
  6. the characteristic fatty acid profile of cardiolipin is not determined by the substrate specificity of tafazzin PMID: 19700766

Show More

Hide All

Subcellular Location
Mitochondrion outer membrane; Peripheral membrane protein; Intermembrane side. Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side. Mitochondrion.; [Isoform A]: Mitochondrion membrane.; [Isoform B]: Mitochondrion membrane. Golgi apparatus membrane. Endoplasmic reticulum membrane.; [Isoform C]: Mitochondrion membrane.
Protein Families
Taffazin family
Database Links

KEGG: dme:Dmel_CG8766

STRING: 7227.FBpp0086975

UniGene: Dm.6762

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1