Recombinant Drosophila melanogaster Tyramine/octopamine receptor(Oct-TyrR)

Code CSB-CF322124DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P22270
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence VSTTKSGSGNAARGYTDSDDDAGMGTEAVANISGSLVEGLTTVTAALSTAQADKDSAGEC EGAVEELHASILGLQLAVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNF FIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALD RYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGWNDWPDEFTSATPCELTSQ RGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERARANKLNTIALKSTELEPMANSS PVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESISSETHQPQDSSKAGPHGNSDP QQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEPHGEQQLLPAGGDGGSCQPGG GHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVAAVSVTPLQKKT SGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCCPTNKFKN FITWLGYINSGLNPVIYTIFNLDYRRAFKRLLGLN
Source in vitro E.coli expression system
Gene Names Oct-TyrR
Protein Names Recommended name: Tyramine/octopamine receptor Alternative name(s): Tyr/Oct-Dro
Expression Region 27-601
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for both octopamine and tyramine, invertebrate neurotransmitters, and neuromodulators. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The rank order of potency for agonists is tyramine > octopamine > dopamine > epinephrine > norepinephrine > serotonin > histamine. For antagonists, the rank order is yohimbine > chlorpromazine > phentolamine > mianserine > cyproheptadine > dihydroergotamine > clonidine > synephrine. Tyramine has a functional role in the olfactory system as a neurotransmitter or a neuromodulator.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Preferentially expressed in Drosophila heads.
Database Links

KEGG: dme:Dmel_CG7485

STRING: 7227.FBpp0078132

UniGene: Dm.3507

Related Products

Oct-TyrR Antibodies

Oct-TyrR Antibodies for Drosophila melanogaster (Fruit fly)

Oct-TyrR Proteins

Oct-TyrR Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.