Recombinant Drosophila melanogaster Tyramine/octopamine receptor(Oct-TyrR)

Code CSB-CF322124DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P22270
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Drosophila melanogaster (Fruit fly)
Sequence VSTTKSGSGNAARGYTDSDDDAGMGTEAVANISGSLVEGLTTVTAALSTAQADKDSAGEC EGAVEELHASILGLQLAVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNF FIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALD RYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGWNDWPDEFTSATPCELTSQ RGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERARANKLNTIALKSTELEPMANSS PVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESISSETHQPQDSSKAGPHGNSDP QQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEPHGEQQLLPAGGDGGSCQPGG GHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVAAVSVTPLQKKT SGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCCPTNKFKN FITWLGYINSGLNPVIYTIFNLDYRRAFKRLLGLN
Source in vitro E.coli expression system
Gene Names Oct-TyrR
Protein Names Recommended name: Tyramine/octopamine receptor Alternative name(s): Tyr/Oct-Dro
Expression Region 27-601
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for both octopamine and tyramine, invertebrate neurotransmitters, and neuromodulators. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The rank order of potency for agonists is tyramine > octopamine > dopamine > epinephrine > norepinephrine > serotonin > histamine. For antagonists, the rank order is yohimbine > chlorpromazine > phentolamine > mianserine > cyproheptadine > dihydroergotamine > clonidine > synephrine. Tyramine has a functional role in the olfactory system as a neurotransmitter or a neuromodulator.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Preferentially expressed in Drosophila heads.
Database Links

KEGG: dme:Dmel_CG7485

STRING: 7227.FBpp0078132

UniGene: Dm.3507

Related Products

Oct-TyrR Antibodies

Oct-TyrR Antibodies for Drosophila melanogaster (Fruit fly)

Oct-TyrR Proteins

Oct-TyrR Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.