Recombinant Drosophila melanogaster Zinc transporter foi (foi)

Code CSB-CF895187DLU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
foi
Uniprot No.
Alternative Names
foi; CG6817; Zinc transporter foi; Protein fear-of-intimacy; Protein kastchen
Species
Drosophila melanogaster (Fruit fly)
Expression Region
22-706
Target Protein Sequence
QDHIESLLGPARVTTHNSQDQLNARVYTNLSPSSETTDRRQQRSASGDDDTFNYSISPPS RREKRHAGHEHGPTSESRVPQITQYYLEKLMAQDELMNSSGFDGLLQQLSLHSLASGASE GTCVPGSRLVHHVQPHDHHHAHHHEEEDHSLQLNNCTLIQNGTTSNVICPSLPNNNTHPL GKEAKNFTLSDKDLLHLCPILLYELKAQSGGCIEPAILSDIDTTEELLEAEKDKDIFYVW IYAFISVFACGILGLVGVAIIPFMGSRYYKYIIQYLVALAVGTMTGDALLHLLPHSLAGQ DERGMIMKGLGCLGGIIFFYVMEHALTMISEWRKSVEKKETKKPSRAKVMRDPDSSVNNS VAGDKICKQKYSSYPYCYDEITMNNKQSEWMHLPFDVAAGAGGDAPSVAELRNGVGDHDG SNDMAAAAESLISPLHTNCVEMNHHNHNHKHNSHQQNHEGQDSNTIVTDLDGNAVYAVNK AKDKDSRNDHVTVILREHESSHHGHSHRHGHVHSPPETLSAVAWMIIMGDGLHNFTDGMA IGAAFAENIAGGFSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMI FGIAFGQSQDVAQWMFAVAAGLFIYIALVDMMPEISASHKSLGQFLLQILGMLSGVGIML LIALYEGDLMSAFGTAGAASHQHAH
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for the normal migration of longitudinal and peripheral glial cells. During larval development, required for the migration of the subretinal glia into the eye disk. During embryonic development, also controls the migration of muscle cells toward their attachment sites. Required in the mesoderm for the correct morphogenesis of embryonic gonad and for tracheal branch fusion during tracheal development. Shg may be cooperating with foi to mediate a common mechanism for gonad and tracheal morphogenesis. Acts as a zinc transporter in both yeast and mammalian cells.
Gene References into Functions
  1. ZIP transporter Fear-of-intimacy (Foi) is necessary for the formation of Drosophila muscles. PMID: 27068109
  2. cell-surface protein required in the mesoderm for gonad morphogenesis PMID: 12702650
  3. in vivo structure-function analysis of FOI that strongly indicates that zinc transport activity of FOI is essential for gonad development PMID: 16481356
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
ZIP transporter (TC 2.A.5) family
Tissue Specificity
Maternal foi has almost completely disappeared by embryonic stage 3 except in the pole cells. In stage 6 embryos, expression is enriched in the invaginating mesoderm. In stage 9 embryos, high levels in the anterior and posterior midgut primordia. In stage
Database Links

KEGG: dme:Dmel_CG6817

STRING: 7227.FBpp0076350

UniGene: Dm.2818

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×