Recombinant Drosophila virilis Opsin Rh4(Rh4)

Code CSB-CF323794DMP
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P17646
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila virilis (Fruit fly)
Sequence MDIAGSLCNASEGPVLRPEARVSGNGDLQFLGWNVPPDQIQHIPEHWLTQLEPPASMHYM LGVFYIFLFCASTVGNGMVIWIFSTSKALRTPSNMFVLNLAVFDFIMCLKAPIFIYNSFH RGFALGNTGCQIFAAIGSYSGIGAGMTNAAIGYDRLNVITKPMNRNMTFTKAIIMNVIIW LYCTPWVVLPLTQFWDRFVPEGYLTSCTFDYLTDNFDTRLFVGTIFFFSFVCPTLMIIYY YSQIVGHVFSHEKALREQAKKMNVESLRSNVDKSKDTAEIRIAKAAITICFLFFVSWTPY GVMSLIGAFGDKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRMELQKRCPWLAIDE KAPESSSAASTTTTQEQQQTTAA
Source in vitro E.coli expression system
Gene Names Rh4
Protein Names Recommended name: Opsin Rh4 Alternative name(s): Inner R7 photoreceptor cells opsin
Expression Region 1-383
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily

Related Products

Rh4 Antibodies

Rh4 Antibodies for Drosophila virilis (Fruit fly)

Rh4 Proteins

Rh4 Proteins for Drosophila virilis (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.