Recombinant Enterobacteria phage PRD1 Protein P16(XVI)

Code CSB-CF340875EDO(A4)
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P27392
Storage Buffer Tris-based buffer,50% glycerol
Species Enterobacteria phage PRD1 (Bacteriophage PRD1)
Sequence MDKKKLLYWVGGGLVLILIWLWFRNRPAAQVASNWEGPPYMTYNQPQAGSVTLPVAGYTSPSPTLPNRNRSCGCNPAVSAAMAQGADLASKLTDSITSQLNDYASSLNDYLASQAGV
Source in vitro E.coli expression system
Gene Names XVI
Protein Names Recommended name: D(1A) dopamine receptorAlternative name(s): Dopamine D1 receptorRecommended name: Protein P16 Alternative name(s): GpS Protein S
Expression Region 1-117
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Protein of the infection vertex complex, which increases the vertex stability. Anchors the vertex structure to the viral membrane. Essential for viral infectivity.
Subcellular Location Virion membrane, Single-pass membrane protein
Database Links

KEGG: vg:1260929

Related Products

XVI Antibodies

XVI Antibodies for Enterobacteria phage PRD1 (Bacteriophage PRD1)

XVI Proteins

XVI Proteins for Enterobacteria phage PRD1 (Bacteriophage PRD1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.