Recombinant Enterobacteria phage PRD1 Protein P18(XVIII)

Code CSB-CF335290EDO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P27389
Storage Buffer Tris-based buffer,50% glycerol
Species Enterobacteria phage PRD1 (Bacteriophage PRD1)
Sequence MPFGLIVIGIILAIAAYRDTLGELFSIIKDVSKDAKGFGYWVLAAVILGFAASIKPIKEP VNAFMILLMIVLLIRKRGAIDQISNQLRGS
Source in vitro E.coli expression system
Gene Names XVIII
Protein Names Recommended name: Protein P18 Alternative name(s): GpM Protein M
Expression Region 1-90
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the phage injection machinery. Required for DNA injection in the membrane transformation event. Involved in the formation of the membrane tail tube to connect the virus interior with the host cytosol. Essential for viral infectivity.
Subcellular Location Virion membrane, Multi-pass membrane protein
Database Links

KEGG: vg:1260946

Related Products

XVIII Antibodies

XVIII Antibodies for Enterobacteria phage PRD1 (Bacteriophage PRD1)

XVIII Proteins

XVIII Proteins for Enterobacteria phage PRD1 (Bacteriophage PRD1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.