Recombinant Enterobacteria phage PRD1 Protein P34(XXXIV)

Code CSB-CF338833EDO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P27390
Storage Buffer Tris-based buffer,50% glycerol
Species Enterobacteria phage PRD1 (Bacteriophage PRD1)
Sequence MNDFVGPIVTVLTAIIGVAILAVLVSRNSNTAGVIKAGSGGFSSMLGTALSPVTGGTGFA MTNNYSGF
Source in vitro E.coli expression system
Gene Names XXXIV
Protein Names Recommended name: Protein P34 Short name= Protein O Alternative name(s): GpO
Expression Region 1-68
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Virion membrane, Multi-pass membrane protein
Database Links

KEGG: vg:1260927

Related Products

XXXIV Antibodies

XXXIV Antibodies for Enterobacteria phage PRD1 (Bacteriophage PRD1)

XXXIV Proteins

XXXIV Proteins for Enterobacteria phage PRD1 (Bacteriophage PRD1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.