Recombinant Enterobacteria phage PRD1 Protein P35(XXXV)

Code CSB-CF659687EDO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3T4L9
Storage Buffer Tris-based buffer,50% glycerol
Species Enterobacteria phage PRD1 (Bacteriophage PRD1)
Sequence MMENDEWWKYLIFPLVATLGGIVNYSKRALAMKRFSKLEFAVEAVSAAFVGLMVTLGGAA MDLSPHWLGMAAGMSGWMGADFVKAVFSQFVQSKIAPINQPGPIDSDNDKPGRTFND
Source in vitro E.coli expression system
Gene Names XXXV
Protein Names Recommended name: Protein P35 Alternative name(s): Holin
Expression Region 1-117
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Lytic enzyme that is involved in host cell lysis and liberation of progeny phages, by permeabilizing the host cytoplasmic membrane. Permeabilization by holin allows digestion of host proteoglycan by protein P15 (endolysin).
Subcellular Location Host membrane, Multi-pass membrane protein
Database Links

KEGG: vg:5729504

Related Products

XXXV Antibodies

XXXV Antibodies for Enterobacteria phage PRD1 (Bacteriophage PRD1)

XXXV Proteins

XXXV Proteins for Enterobacteria phage PRD1 (Bacteriophage PRD1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.