Recombinant Escherichia coli Aerotaxis receptor (aer)

Code CSB-CF342683ENV
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
aer
Uniprot No.
Alternative Names
aer; air; yqjJ; b3072; JW3043; Aerotaxis receptor
Species
Escherichia coli (strain K12)
Expression Region
1-506
Target Protein Sequence
MSSHPYVTQQNTPLADDTTLMSTTDLQSYITHANDTFVQVSGYTLQELQGQPHNMVRHPD MPKAAFADMWFTLKKGEPWSGIVKNRRKNGDHYWVRANAVPMVREGKISGYMSIRTRATD EEIAAVEPLYKALNAGRTSKRIHKGLVVRKGWLGKLPSLPLRWRARGVMTLMFILLAAML WFVAAPVVTYILCALVVLLASACFEWQIVRPIENVAHQALKVATGERNSVEHLNRSDELG LTLRAVGQLGLMCRWLINDVSSQVSSVRNGSETLAKGTDELNEHTQQTVDNVQQTVATMN QMAASVKQNSATASAADKLSITASNAAVQGGEAMTTVIKTMDDIADSTQRIGTITSLIND IAFQTNILALNAAVEAARAGEQGKGFAVVAGEVRHLASRSANAANDIRKLIDASADKVQS GSQQVHAAGRTMEDIVAQVKNVTQLIAQISHSTLEQADGLSSLTRAVDELNLITQKNAEL VEESAQVSAMVKHRASRLEDAVTVLH
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Signal transducer for aerotaxis. The aerotactic response is the accumulation of cells around air bubbles. The nature of the sensory stimulus detected by this protein is the proton motive force or cellular redox state. It uses a FAD prosthetic group as a redox sensor to monitor oxygen levels.
Gene References into Functions
  1. Oxidized Aer activates CheA, whereas ASQ Aer reversibly inhibits CheA. PMID: 27803157
  2. These studies demonstrated trigonal interactions among the F1 linkers from three Aer monomers, presumably within trimer-of-dimer units, as well as binary interactions between subunits. PMID: 21097634
  3. Gain-of-function mutations are associated with the signalling pathway in the PAS domain of Aer. PMID: 20545849
  4. functional interactions between the PAS domain and the HAMP AS-2 helix are required for FAD binding and aerotactic signaling by Aer. PMID: 15489456
  5. Dimers also formed in mutants that did not bind flavin adenine dinucleotide and in truncated peptides without a signaling domain and part of the HAMP domain. PMID: 15489458
  6. Either the PAS or signalling domains could be deleted from the non-signalling subunit of the Aer heterodimer, but removing 16 residues from the C-terminus of the signalling subunit abolished aerotaxis. PMID: 16430703
  7. Mutations and truncations in the sequence encoding residues 15 to 21 introduced a range of phenotypes, including defects in FAD binding, constant tumbling motility, and an inverse response in which E. coli cells migrated away from oxygen concentrations PMID: 16513745
  8. EilA activates the genetically linked high molecular weight bacterial surface protein Air PMID: 16762026
  9. strong Aer responses to oxygen are associated with redox changes in NADH dehydrogenase I PMID: 16995896
  10. the overall membrane organization of Aer included a maximum of three Aer dimers, did not swap neighbors over time, and appeared to be constrained by interactions in the cytosolic signaling domain. PMID: 17693513
  11. Data confirmed that the Aer HAMP domain is composed of two alpha-helices separated by a structured loop and significance of the HAMP and proximal signaling domain structure for signal transduction is discussed. PMID: 18203838
  12. The aer mutant exhibited a decreased ability to colonize the intestine when compared to wild-type cells. PMID: 19130287

Show More

Hide All

Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Note=Predominantly localized to one cell pole in mid-to-late exponential phase, with a few smaller foci elsewhere in the cell.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1