Recombinant Escherichia coli Hydrogenase-4 component E(hyfE)

Code CSB-CF365208ENV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0AEW1
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Sequence MTGSMIVNNLAGLMMLTSLFVISVKSYRLSCGFYACQSLVLVSIFATLSCLFAAEQLLIW SASAFITKVLLVPLIMTYAARNIPQNIPEKALFGPAMMALLAALIVLLCAFVVQPVKLPM ATGLKPALAVALGHFLLGLLCIVSQRNILRQIFGYCLMENGSHLVLALLAWRAPELVEIG IATDAIFAVIVMVLLARKIWRTHGTLDVNNLTALKG
Source in vitro E.coli expression system
Gene Names hyfE
Protein Names Recommended name: Hydrogenase-4 component E EC= 1.-.-.-
Expression Region 1-216
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Possible component of hydrogenase 4.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Database Links

KEGG: ecj:JW2470

STRING: 316385.ECDH10B_2651

Related Products

hyfE Antibodies

hyfE Antibodies for Escherichia coli (strain K12)

hyfE Proteins

hyfE Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.