Recombinant Escherichia coli Lactose permease (lacY), partial

In Stock
Code CSB-CF365806ENV1
Abbreviation Recombinant E.coli lacY protein, partial
MSDS
Size $878
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
lacY
Uniprot No.
Research Area
Others
Alternative Names
lacY; b0343; JW0334; Lactose permease; Lactose-proton symport
Species
Escherichia coli (strain K12)
Source
in vitro E.coli expression system
Expression Region
1-250aa
Target Protein Sequence
MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDTGIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNILVGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFTINNQFVFWLGSGCALILAVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKLWFLSLYVIGVSCTYDVFDQQFANFFTSF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.4 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli Lactose permease (lacY) is produced using an in vitro E.coli expression system, featuring an N-terminal 10xHis-tag for simplified purification. This partial protein covers amino acids 1-250 and achieves a purity greater than 85% as confirmed by SDS-PAGE. It's designed for research use only, with no endotoxin level specified, ensuring it meets the quality standards necessary for laboratory applications.

Lactose permease appears to be a critical component in Escherichia coli, helping transport lactose across the cell membrane. As a symporter, it plays what seems to be a fundamental role in sugar metabolism by coupling lactose transport with proton translocation. This enables efficient lactose uptake. Studying this protein may be pivotal in understanding membrane transport mechanisms and could provide insights into similar processes in other organisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Escherichia coli lacY is a complex transmembrane protein with 12 transmembrane helices that requires precise folding, proper membrane insertion, and specific tertiary structure for its functional activity in lactose transport. The in vitro E. coli expression system (cell-free) cannot provide the membrane environment, lipid interactions, or cellular machinery necessary for correct folding, helix packing, and insertion into a lipid bilayer. The partial fragment (1-250aa) represents only about half of the full-length protein (417aa) and lacks critical transmembrane domains and functional regions. The N-terminal 10xHis-tag, while small, does not mitigate the fundamental folding issues. The probability of correct folding with functional bioactivity is essentially zero.

1. Antibody Development and Validation

This application has severe limitations. While antibodies can be generated against linear epitopes, they will not recognize conformational epitopes of the native, membrane-embedded lacY. Antibodies may primarily target the misfolded regions and fail to bind the properly folded protein in its physiological context, limiting their utility for studying native lacY function.

2. Structural and Biochemical Characterization

Basic biophysical analysis can be performed but will not reflect native lacY structure. Techniques like circular dichroism spectroscopy will characterize the misfolded, aggregated state of this membrane protein fragment rather than the physiological structure. Results will describe an artificial construct rather than the functional transmembrane protein.

Final Recommendation & Action Plan

This cell-free expressed partial lacY fragment is unsuitable for any functional studies due to the essential requirements for membrane insertion and complete tertiary structure that cannot be met in this system. The protein will be misfolded and aggregated without the necessary lipid environment. Applications 1 and 2 have severe limitations and will not provide meaningful insights into native lacY biology. For reliable lacY research, use full-length protein expressed in membrane-containing systems (e.g., E. coli membranes, nanodiscs, or proteoliposomes) with proper folding validation through transport assays or biophysical methods that confirm membrane insertion and function.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for transport of beta-galactosides into the cell, with the concomitant import of a proton (symport system). Can transport lactose, melibiose, lactulose or the analog methyl-1-thio-beta,D-galactopyranoside (TMG), but not sucrose or fructose. The substrate specificity is directed toward the galactopyranosyl moiety of the substrate.
Gene References into Functions
  1. Binding kinetics of alpha-galactopyranoside homologs with fluorescent aglycones of different sizes or shapes were determined with Escherichia coli LacY by FRET from Trp151 in the LacY binding site to the fluorophores. LacY specificity is directed toward the galactopyranoside ring. The pathway for the substrate entering from the periplasmic side is wider than the calculated pore diameters in periplasmic open X-ray struc... PMID: 29602806
  2. Glu325 exhibits a pKa of 10.5 +/- 0.1 that is insensitive to the presence of galactopyranoside. Protonation of Glu325 specifically is required for effective sugar binding to LacY PMID: 28154138
  3. Data indicate that the nanobodies (Nbs) bind stoichiometrically with nanomolar affinity to the periplasmic face of lactose permease (LacY) primarily to the C-terminal six-helix bundle. PMID: 27791182
  4. Molecular dynamics simulations indicated that the deprotonation of Glu325 induced the opening of the periplasmics side and partial closure of the cytoplasmic side of LacY, while protonation of the Glu269 caused a stable cross-domain salt-bridge (Glu130-Arg344) and completely closed the cytoplasmic side. PMID: 27090495
  5. Double-replacement mutants of conserved Gly-Gly pairs bind galactoside with affinities 10-20-fold higher than that of the pseudo-WT or WT LacY. Moreover, site-directed alkylation of a periplasmic Cys replacement indicates that the periplasmic cavity becomes readily accessible in the double-replacement mutants. PMID: 27438891
  6. WT LacY in complex with the great majority of the Nbs exhibits varied increases in access of sugar to the binding site with an increase in association rate constants (kon) of up to approximately 50-fold (reaching 10(7) M(-1) s(-1)). PMID: 25512549
  7. The lactose permease gene (lacY) was overexpressed in the septuple knockout mutant of Escherichia coli.. inactivate the lactose repressor, induce the lactose operon, and as a result stimulate overall lactose consumption and conversion. PMID: 23725289
  8. Data indicate that opening of the periplasmic cavity not only limits access of sugar to the binding site of lactose permease (LacY) but also controls the rate of closing of the cytoplasmic cavity. PMID: 24872451
  9. Exploit chemical denaturation to determine the unfolding free energy of LacY and employ Trp residues as site-specific thermodynamic probes. Trp LacY mutants are created with the individual Trps situated at mirror image positions on the two LacY domains. PMID: 24530957
  10. findings are consistent with the interpretation that the electrogenic reaction induced by sugar binding is due to rearrangement of charged residues in LacY and that this reaction is blocked by mutation of each member of the Tyr236/Glu269/His322 triad PMID: 24152072
  11. Trp replacements for tightly interacting Gly-Gly pairs in LacY stabilize an outward-facing conformation. PMID: 23671103
  12. Proper fatty acid composition rather than an ionizable lipid amine is required for full transport function of lactose permease from Escherichia coli PMID: 23322771
  13. Data indicate that transmembrane domains (TMs) orientation for lactose permease LacY as a function of membrane lipid composition. PMID: 22969082
  14. study led to the discovery that LacY activity is a major physiological source of expression costs in the lac operon PMID: 22605776
  15. analysis of the intermediate conformational state of LacY PMID: 22355148
  16. Results indicate that LacY exhibits specificity directed toward the galactopyranosyl moiety of the glycoside to be transported. PMID: 22106930
  17. LacY is highly dynamic, and binding of a galactopyranoside causes closing of the inward-facing cavity with opening of a complementary outward-facing cavity. PMID: 21995338
  18. analysis of the interaction between helices V and I and its role in the transport mechanism of LacY protein PMID: 21730060
  19. Data show that MTS-gal is bound covalently, forming a disulfide bond with MTS-gal is bound covalently, forming a disulfide bond with Cys122 LacY and positioned between R144 and W151. PMID: 21593407
  20. topology of both CscB & PheP permeases is dependent on PE. However, CscB topology is governed by thermodynamic balance between opposing lipid-dependent electrostatic and hydrophobic interactions. PMID: 21454589
  21. Results describe a structural model of LacY generated by swapping the conformations of inverted-topology repeats identified in its two domains. PMID: 21315728
  22. Ser53, Gln60, and Phe354 are determined to be important in sugar transport during the periplasmic-open stage of the sugar transport cycle and the sugar is found to undergo an orientational change in order to escape the protein lumen. PMID: 20875429
  23. LacY exhibits uphill transport and native conformation of periplasmic domain P7 when expressed in a mutant in which phosphatidylcholine completely replaces phosphatidylethanolamine PMID: 20696931
  24. Electrogenic reactions accompanying downhill lactose/H(+) symport catalyzed by the lactose permease of Escherichia coli (LacY) have been assessed using solid-supported membrane-based electrophysiology with improved time resolution. PMID: 20568736
  25. demonstrate that sugar binding induces virtually the same global conformational change in LacY whether the protein is in the native bacterial membrane or is solubilized and purified in detergent. PMID: 20457922
  26. Data report the insertion of E. coli lactose permease in supported lipid bilayers of 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine (POPE) and 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol (POPG), in biomimetic molar proportions. PMID: 20096263
  27. Together with results from previous mutagenesis and cross-linking studies, these findings lead to a model in which replacement of Asp68 blocks a conformational transition involving helices II and IV that is important for opening the periplasmic cavity. PMID: 20043916
  28. analysis of sugar recognition by the LacY lactose permease of Escherichia coli PMID: 15364943
  29. LacY activity is dependent on subtle interactions between the helices, and mutations that disrupt interactions between helix IV and loop 6-7 or between helices II and IV also rescue transport in the cysteine154glycine mutant. PMID: 15909981
  30. reactivity of single-Cys mutants in helices I, III, VI, and XI of lactose permease with N-ethylmaleimide or methanethiosulfonate ethylsulfonate was studied in membrane vesicles. Most Cys replacements react with membrane-permeant alkylating agent NEM. PMID: 16566592
  31. Functional analyses of mutants in the homologous key residues provide strong evidence that they play a similar critical role in the mechanisms of CscB and LacY. PMID: 16574149
  32. structurally diverse lipids endow the membrane with similar properties necessary for the proper organization of protein domains in LacY that are highly sensitive to lipids as topological determinants PMID: 16698795
  33. thermodynamic analysis of ligand-induced conformational flexibility in the lactose permease of Escherichia coli PMID: 17003033
  34. model in which the single sugar-binding site in the approximate middle of the molecule is alternately exposed to either side of the membrane due to opening and closing of cytoplasmic and periplasmic hydrophilic cavities PMID: 17172438
  35. analysis of the x-ray structure of wild-type lactose permease (LacY) from Escherichia coli determined by manipulating phospholipid content during crystallization PMID: 17881559
  36. Double electron-electron resonance in conjunction with molecular modeling based on the x-ray structure provide strong support for the alternative access model and reveal a structure for the outward-facing conformer of LacY. PMID: 17925435
  37. The results provide direct support for the argument that transport via LacY involves opening and closing of a large periplasmic cavity. PMID: 18319336
  38. The results are consistent with the conclusion that LacY is protonated before sugar binding during lactose/H(+) symport in either direction across the membrane. PMID: 18567672
  39. ProP activity increased as LacY activity decreased when osmotic stress (increasing osmolality) was imposed on right-side-out cytoplasmic membrane vesicles. PMID: 18620422
  40. LacY involves at least 2 electrogenic reactions:a minor electrogenic step and a major electrogenic step. PMID: 19383792
  41. The data indicate that residues Ile40 and Asn245 play a primary role in gating the periplasmic cavity and provide further support for the alternating-access model. PMID: 19781551

Show More

Hide All

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Protein Families
Major facilitator superfamily, Oligosaccharide:H(+) symporter (OHS) (TC 2.A.1.5) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*