Recombinant Escherichia coli Lipid A export ATP-binding/permease protein MsbA (msbA)

Code CSB-CF350970ENV
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
msbA
Uniprot No.
Alternative Names
msbA; b0914; JW0897; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA; Lipid flippase
Species
Escherichia coli (strain K12)
Expression Region
1-582
Target Protein Sequence
MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in lipopolysaccharide (LPS) biosynthesis. Translocates lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane and the ATP-binding domain (NBD) is responsible for energy generation. Shows ATPase activity. May transport glycerophospholipids. In proteoliposomes, mediates the ATP-dependent flipping of a variety of phospholipid and glycolipid derivatives. May also function as a multidrug transporter.
Gene References into Functions
  1. The ABC exporter MsbA can couple ATP hydrolysis to an adenylate kinase activity, where ADP is converted into AMP and ATP. Single-point mutations reveal that both ATPase and adenylate kinase mechanisms are associated with the same conserved motifs of the nucleotide-binding domain. PMID: 28004795
  2. Data show that the conformational space of lipid ABC transporter MsbA changes upon vanadate trapping. PMID: 29069570
  3. Data show that the twisting motion of ATP-binding cassette transporter MsbA plays an important role for the rearrangement of transmembrane helices and the opening of transmembrane domains on the periplasmic side. PMID: 26148303
  4. Data indicate that E208A mutation interrupts the inward- to outward-facing conformational switch in ATP-binding cassette transport protein MsbA. PMID: 23306205
  5. Data show that the isolated MsbA nucleotide-binding domain hydrolyzed ATP with V(max) = 45 nmol mg(-1) min(-1), similar to the full-length transporter. PMID: 22593573
  6. Catalytic activity of MsbA reconstituted in nanodisc particles is modulated by remote interactions with the bilayer PMID: 22020218
  7. analysis of the E506Q and H537A dysfunctional mutants in the E. coli ABC transporter MsbA PMID: 21462989
  8. investigation of catalytic mechanism using mutants: L511P prevents effective ATP hydrolysis; D512G hydrolyzes ATP at rate 3-fold faster than wild type; both mutants bind ATP at near-wild-type levels but are unable to maintain cell viability PMID: 21344946
  9. This is the first report of a direct measurement of lipid flippase activity of purified MsbA in a reconstituted system. PMID: 20412049
  10. result suggests that deletion of the C-terminal alpha-helices may play a role in facilitating the outward-facing nucleotide-bound crystal structure of EcMsbA. PMID: 20179345
  11. MsbA facilitates the rapid translocation of some lipids from the cytoplasmic to the periplasmic side of the inner membrane in living cells PMID: 15304478
  12. spin-labeling & electron paramagnetic resonance spectroscopy used to characterize the conformational motion coupling energy expenditure to substrate translocation; results establish the structural dynamic basis of the power stroke in MDR ABC transporters PMID: 15890883
  13. Lipopolysaccharide stabilizes the crystal packing of the ABC transporter MsbA PMID: 16511120
  14. the LSGGQ NBD consensus sequence is consistent with an alpha-helical conformation and that these residues maintain extensive tertiary contacts throughout hydrolysis PMID: 17029409
  15. Comparison among 4 x-ray structures of MsbA, trapped in different conformations (2 nucleotide-bound structures & 2 without nucleotide) reveals a flexible hinge formed by extracellular loops 2 & 3, allowing large ranges of motion PMID: 18024585
  16. Proline to serine substitutions at either residue 18 or 50 of MsbA relieved the Kdo growth dependence observed in the isogenic wild-type strain. PMID: 18093093
  17. analysis of the specific residues in these conserved ABC motifs within MsbA indicates that closure of the dimer interface does not occur upon ATP binding in this transporter. PMID: 19053284
  18. MsbA can act as multidrug transporter, consistent with its structural similarities with the human multidrug resistance P-glycoprotein ABCB1, and transmembrane helix 6 plays an important role in the binding and transport of multiple drugs. PMID: 18803398

Show More

Hide All

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1