Recombinant Escherichia coli Modulator of FtsH protease YccA(yccA)

Code CSB-CF364471ENV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0AAC6
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Sequence MDRIVSSSHDRTSLLSTHKVLRNTYFLLSLTLAFSAITATASTVLMLPSPGLILTLVGMY GLMFLTYKTANKPTGIISAFAFTGFLGYILGPILNTYLSAGMGDVIAMALGGTALVFFCC SAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILISSGAILFET SNIIHGGETNYIRATVSLYVSLYNIFVSLLSILGFASRD
Source in vitro E.coli expression system
Gene Names yccA
Protein Names Recommended name: Modulator of FtsH protease YccA
Expression Region 1-219
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Negatively modulates the activity of the FtsH protease for membrane substrates. Overexpression or stabilizing YccA counteracts the FtsH-mediated degradation of SecY when the SecYEG preprotein translocator is jammed.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families BI1 family
Database Links

KEGG: ecj:JW0953

STRING: 316385.ECDH10B_1040

Related Products

yccA Antibodies

yccA Antibodies for Escherichia coli (strain K12)

yccA Proteins

yccA Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.