Recombinant Escherichia coli Putative colanic biosynthesis UDP-glucose lipid carrier transferase(wcaJ)

Code CSB-CF300941ENV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P71241
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Sequence MTNLKKRERAKTNASLISMVQRFSDITIMFAGLWLVCEVSGLSFLYMHLLVALITLVVFQ MLGGITDFYRSWRGVRAATEFALLLQNWTLSVIFSAGLVAFNNDFDTQLKIWLAWYALTS IGLVVCRSCIRIGAGWLRNHGYNKRMVAVAGDLAAGQMLMESFRNQPWLGFEVVGVYHDP KPGGVSNDWAGNLQQLVEDAKAGKIHNVYIAMQMCDGARVKKLVHQLADTTCSVLLIPDV FTFNILHSRLEEMNGVPVVPLYDTPLSGVNRLLKRAEDIVLATLILLLISPVLCCIALAV KLSSPGPVIFRQTRYGMDGKPIKVWKFRSMKVMENDKVVTQATQNDPRVTKVGNFLRRTS LDELPQFINVLTGGMSIVGPRPHAVAHNEQYRQLIEGYMLRHKVKPGITGWAQINGWRGE TDTLEKMEKRVEFDLEYIREWSVWFDIKIVFLTVFKGFVNKAAY
Source in vitro E.coli expression system
Gene Names wcaJ
Protein Names Recommended name: Putative colanic biosynthesis UDP-glucose lipid carrier transferase
Expression Region 1-464
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Is the initiating enzyme for colanic acid (CA) synthesis. Catalyzes the transfer of the glucose-1-phosphate moiety from UDP-Glc onto the carrier lipid undecaprenyl phosphate (C55-P), forming a phosphoanhydride bond yielding to glucosyl-pyrophosphoryl-undecaprenol (Glc-PP-C55). Also possesses a weak galactose-1-P transferase activity.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Bacterial sugar transferase family
Database Links

KEGG: ecj:JW2032

STRING: 316385.ECDH10B_2197

Related Products

wcaJ Antibodies

wcaJ Antibodies for Escherichia coli (strain K12)

wcaJ Proteins

wcaJ Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.