Recombinant Escherichia coli Putative permease perM(perM)

Code CSB-CF360271ENV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0AFI9
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Sequence MLEMLMQWYRRRFSDPEAIALLVILVAGFGIIFFFSGLLAPLLVAIVLAYLLEWPTVRLQ SIGCSRRWATSIVLVVFVGILLLMAFVVLPIAWQQGIYLIRDMPGMLNKLSDFAATLPRR YPALMDAGIIDAMAENMRSRMLTMGDSVVKISLASLVGLLTIAVYLVLVPLMVFFLLKDK EQMLNAVRRVLPRNRGLAGQVWKEMNQQITNYIRGKVLEMIVVGIATWLGFLLFGLNYSL LLAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGAGTEFWSCFAVYLIIQALDGNLLVPVL FSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKAVIHAWPDGQIAQE
Source in vitro E.coli expression system
Gene Names perM
Protein Names Recommended name: Putative permease perM
Expression Region 1-353
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Autoinducer-2 exporter (AI-2E) (TC 2.A.86) family
Database Links

KEGG: ecj:JW2478

STRING: 316385.ECDH10B_2659

Related Products

perM Antibodies

perM Antibodies for Escherichia coli (strain K12)

perM Proteins

perM Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.