Recombinant Escherichia coli Putative type II secretion system protein L(gspL)

Code CSB-CF332708ENV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P45763
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Sequence MPESLMVIRSSSTLRKHWEWMTFSADSVSSVHTLTDDLPLESLADQPGAGNVHLLIPPEG LLYRSLTLPNAKYKLTAQTLQWLAEETLPDNTQDWHWTVVDKQNESVEVIGIQSEKLSRY LERLHTAGLNVTRVLPDGCYLPWEVDSWTLVNQQTSWLIRSAAHAFNELDEHWLQHLAAQ FPPENMLCYGVVPHGVAAANPLIQHPEIPSLSLYSADIAFQRYDMLHGIFRKQKTVSKSG KWLARLAVSCLVLAILSFVGSRSIALWHTLKIEDQLQQQQQETWQRYFPQIKRTHNFRFY FKQQLAQQYPEAVPLLYHLQTLLLEHPELQLMEANYSQKQKSLTLKMSAKSEANIDRFCE LTQSWLPMEKTEKDPVSGVWTVRNSGK
Source in vitro E.coli expression system
Gene Names gspL
Protein Names Recommended name: Putative type II secretion system protein L Short name= T2SS protein L Alternative name(s): Putative general secretion pathway protein L
Expression Region 1-387
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in a type II secretion system (T2SS, formerly general secretion pathway, GSP) for the export of proteins.
Subcellular Location Cell inner membrane, Single-pass membrane protein
Protein Families GSP L family
Database Links

KEGG: ecj:JW5705

STRING: 316385.ECDH10B_3508

Related Products

gspL Antibodies

gspL Antibodies for Escherichia coli (strain K12)

gspL Proteins

gspL Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.