Recombinant Escherichia coli Uncharacterized protein ybdJ(ybdJ)

Code CSB-CF302056ENV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P77506
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Sequence MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLMDLSQLYTLLFCLWFL VLGAIEYFVLRFIWRRWFSLAD
Source in vitro E.coli expression system
Gene Names ybdJ
Protein Names Recommended name: Uncharacterized protein ybdJ
Expression Region 1-82
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: ecj:JW0569

STRING: 316385.ECDH10B_0646

Related Products

ybdJ Antibodies

ybdJ Antibodies for Escherichia coli (strain K12)

ybdJ Proteins

ybdJ Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.