Recombinant Gorilla gorilla gorilla N-formyl peptide receptor 2(FPR2)

Code CSB-CF008855GGZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P79177
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Gorilla gorilla gorilla (Western lowland gorilla)
Sequence NFSTPLNEHEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTIC YLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDR CICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASW GGTPEERQKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVL TAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYV FVGQDFRERLIHSLPTSLERALSEDSAPTNDTAASCASPPAETELQAM
Source in vitro E.coli expression system
Gene Names FPR2
Protein Names Recommended name: N-formyl peptide receptor 2 Alternative name(s): FMLP-related receptor I Short name= FMLP-R-I Formyl peptide receptor-like 1
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 9593.ENSGGOP00000005547

Related Products

FPR2 Proteins

FPR2 Proteins for Gorilla gorilla gorilla (Western lowland gorilla)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.