Recombinant Gossypium barbadense Cytochrome b559 subunit alpha(psbE)

Code CSB-CF371457GEP
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A0ZZ52
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Gossypium barbadense (Sea-island cotton) (Egyptian cotton)
Sequence MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDSLEQLDEFSRSF
Source in vitro E.coli expression system
Gene Names psbE
Protein Names Recommended name: Cytochrome b559 subunit alpha Alternative name(s): PSII reaction center subunit V
Expression Region 1-83
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This b-type cytochrome is tightly associated with the reaction center of photosystem II (PSII). PSII is a light-driven water
Subcellular Location Plastid, chloroplast thylakoid membrane, Single-pass membrane protein
Protein Families PsbE/PsbF family

Related Products

psbE Antibodies

psbE Antibodies for Gossypium barbadense (Sea-island cotton) (Egyptian cotton)

psbE Proteins

psbE Proteins for Gossypium barbadense (Sea-island cotton) (Egyptian cotton)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.