Recombinant Gossypium hirsutum CASP-like protein XL3(XL3)

Code CSB-CF692296GHB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5K4H9
Storage Buffer Tris-based buffer,50% glycerol
Species Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Sequence MELSIQKIEALIRLSTIVMLVLTACLIGLDSQTKVIFYVQKKASFKDLRALVGLLYITSL AAAYNLLQLCCSSFSASYKGTSLQSYAYLAWLRYILDQAVVYAVFAGNLAALEHSFLVLT GEENFQWLKWCNKYTRFCTQIGGSLLCGFVASLLMFSIASISAFNLFRQYSPTKFMHLKL
Source in vitro E.coli expression system
Gene Names XL3
Protein Names Recommended name: CASP-like protein XL3
Expression Region 1-180
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Casparian strip membrane proteins (CASP) family

Related Products

XL3 Antibodies

XL3 Antibodies for Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)

XL3 Proteins

XL3 Proteins for Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.