Recombinant Guinea pig Nociceptin receptor(OPRL1)

Code CSB-CF016360GU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P47748
Storage Buffer Tris-based buffer,50% glycerol
Species Cavia porcellus (Guinea pig)
Sequence MESLFPAPFWEVLYGSHLQGNLSLLSPNHSGLPPHLLLNASHSAFLPLGLKVTIVGLYLA VCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQATDILLGFWPFGN TLCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALALV VGVPVAIMGSAQVEDEEIECLVEIPDPQDYWGPVFAVSIFLFSFIIPVLIISVCYSLMIR RLHGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETTVAI LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREMQVSDRVRSIAKDVALGC KTTETVPRPA
Source in vitro E.coli expression system
Gene Names OPRL1
Protein Names Recommended name: Nociceptin receptor Alternative name(s): Kappa-type 3 opioid receptor Short name= KOR-3 Orphanin FQ receptor XOR
Expression Region 1-370
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function G-protein coupled opioid receptor that functions as receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling via G proteins mediates inhibition of adenylate cyclase activity and calcium channel activity. Arrestins modulate signaling via G proteins and mediate the activation of alternative signaling pathways that lead to the activation of MAP kinases. Plays a role in modulating nociception and the perception of pain. Plays a role in the regulation of locomotor activity by the neuropeptide nociceptin (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein, Cytoplasmic vesicle
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 10141.ENSCPOP00000013520

Related Products

OPRL1 Proteins

OPRL1 Proteins for Cavia porcellus (Guinea pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.