Recombinant Guinea pig Platelet-activating factor receptor(PTAFR)

Code CSB-CF018946GU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P21556
Storage Buffer Tris-based buffer,50% glycerol
Species Cavia porcellus (Guinea pig)
Sequence MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Source in vitro E.coli expression system
Gene Names PTAFR
Protein Names Recommended name: Platelet-activating factor receptor Short name= PAF-R Short name= PAFr
Expression Region 1-342
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 10141.ENSCPOP00000015534

Pathway Calcium signaling pathway

Related Products

PTAFR Proteins

PTAFR Proteins for Cavia porcellus (Guinea pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.