Purity
Greater than 85% as determined by SDS-PAGE.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-319aa
Target Protein Sequence
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND-
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
To produce a recombinant human 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4) protein tagged with an N-terminal 10xHis-tag in an in vitro E. coli expression system, the full-length human AGPAT4 gene fragment (1-319aa) along with an N-terminal 10xHis-tag is cloned into a suitable expression vector with the necessary regulatory elements. The recombinant plasmid DNA containing the AGPAT4 gene fragment is isolated and purified. In vitro transcription is performed using the purified plasmid DNA to synthesize mRNA, which serves as a template in the subsequent in vitro translation reaction. The translation reaction is set up using an E. coli cell-free extract supplemented with energy sources and amino acids. Following incubation, the recombinant AGPAT4 protein is purified from the cell culture medium. The purity of the recombinant AGPAT4 protein, measuring up to 85%, is assessed by SDS-PAGE analysis, where it appears as a band with a molecular weight of approximately 40 kDa.
