Recombinant Human 2-acylglycerol O-acyltransferase 1(MOGAT1)

Code CSB-CF836275HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q96PD6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MKVEFAPLNIQLARRLQTVAVLQWVLKYLLLGPMSIGITVMLIIHNYLFLYIPYLMWLYF DWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFG NFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGN ISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPE GSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQE QIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
Source in vitro E.coli expression system
Gene Names MOGAT1
Protein Names Recommended name: 2-acylglycerol O-acyltransferase 1 EC= 2.3.1.22 Alternative name(s): Acyl-CoA:monoacylglycerol acyltransferase 1 Short name= MGAT1 Diacylglycerol O-acyltransferase candidate 2 Short name= hDC2 Diacylg
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Diacylglycerol acyltransferase family
Database Links

HGNC: 18210

OMIM: 610268

KEGG: hsa:116255

STRING: 9606.ENSP00000406674

UniGene: Hs.344090

Related Products

MOGAT1 Antibodies

MOGAT1 Antibodies for Homo sapiens (Human)

MOGAT1 Antibodies for Human

MOGAT1 Proteins

MOGAT1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.