Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 1(SRD5A1)

Code CSB-CF022653HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P18405
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
Source in vitro E.coli expression system
Gene Names SRD5A1
Protein Names Recommended name: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 EC= 1.3.99.5Alternative name(s): SR type 1 Steroid 5-alpha-reductase 1 Short name= S5AR 1
Expression Region 1-259
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Subcellular Location Microsome membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Steroid 5-alpha reductase family
Tissue Specificity Liver and prostate (at a low level).
Database Links

HGNC: 11284

OMIM: 184753

KEGG: hsa:6715

STRING: 9606.ENSP00000274192

UniGene: Hs.552

Related Products

SRD5A1 Proteins

SRD5A1 Proteins for Homo sapiens (Human)

SRD5A1 ELISA Kit

SRD5A1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.