Recombinant Human 5-hydroxytryptamine receptor 3B (HTR3B)

Code CSB-CF010891HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
HTR3B
Uniprot No.
Alternative Names
HTR3B; 5-hydroxytryptamine receptor 3B; 5-HT3-B; 5-HT3B; Serotonin receptor 3B
Species
Homo sapiens (Human)
Expression Region
22-441
Target Protein Sequence
TDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTS VWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSG TIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAF LNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSF YLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSI VLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEV WSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.
Gene References into Functions
  1. A protective haplotype in HTR3B was also associated with OCD (OR = 0.77, CI = 0.63-0.95, permutated P = 0.0179). These results support that common HTR3 variants are involved in OCD and some of its clinical phenotypes PMID: 27616601
  2. This study did not found HTR3B play a major role in predicting Antipsychotic-Induced Weight Gain. PMID: 28531893
  3. the important role of HTR3B polymorphisms in heroin dependence among the Chinese Han population PMID: 27773795
  4. The HTR3B rs1176744 polymorphisms do not seem to directly influence experimental muscle pain in healthy individuals. However, women reported higher pain intensity and larger pain area than men, which might partly be attributed to genotype. PMID: 28002447
  5. the -AAG deletion variant of the 5-HT3B receptor gene may contribute to variability in response to antiemetic therapy for chemotherapy-induced nausea and vomiting PMID: 27488933
  6. Analysis of our small Chinese sample revealed a significant association of HTR3A with bipolar disorder, but yielded no evidence of an association between HTR3B and bipolar disorder. Furthermore, evidence for an association was found for a haplotype of HTR3A. PMID: 27706728
  7. Study demonstrates that the 5-HT3Br1 transcriptional variant of the 5-HT3B subunit can contribute to the functional properties of heteromeric receptors in a similar manner to the originally characterized 5-HT3B subunit PMID: 25951416
  8. The response to ondansetron for PONV was significantly influenced by the -100_-102AAG deletion polymorphisms of the 5-HT3B gene. Thus, the -100_-102AAG deletion variants may be a pharmacogenetic predictor for responsiveness to ondansetron for PONV. PMID: 26256989
  9. HTR3B gene variants may contribute to variability in severity of and response to antiemetic therapy for nausea and vomiting of pregnancy. PMID: 23786674
  10. we found an association of the HTR3B with poor concentration in schizophrenia patients.These results suggest that the HTR3B may be involved in the attention problem of schizophrenia in Korean population. PMID: 24880582
  11. Data suggest that HTR3A/HTR3B subunits readily form functionally distinct heteromeric receptors; molecular models have been developed regarding affinities of competitive ligands, non-competitive antagonists, and allosteric modulators. [REVIEW] PMID: 23489111
  12. This is the first study to show an association between 5-HTR3B and PCS scores, thus suggesting a role of the serotonin pathway in pain catastrophizing. PMID: 24244382
  13. The ability of 5-HT to gate the homomeric or heteromeric receptor appears to rely on the D loop triplet RQY of the complementary face. PMID: 23810831
  14. variants in HTR3A, HTR3B, and SLC6A4 interactively contribute to etiology of alcohol, cocaine, and nicotine dependence PMID: 24590108
  15. the stoichiometry of 5-HT3AB receptors on the plasma membrane PMID: 23972841
  16. Genetic interactions between HTR3B, HTR3A and SLC6A4 play a significant role in nicotine dependence in both European American and African American smokers. PMID: 23290502
  17. Five single nucleotide polymorphisms (SNPs) in HTR3A and HTR3B were found. PMID: 23464988
  18. Genetic variability within SLC6A4, HTR3A, and HTR3B contributes to the risk of alcohol dependence and related phenotypes. PMID: 23757001
  19. Polymorphisms in the HTR3B gene are predictors of reduced alcohol drinking in response to ondansetron. PMID: 23897038
  20. HTR3A and HTR3B were detected in all investigated brain tissues with the exception of the cerebellum, and large differences in the A:B subunit ratio were observed. PMID: 22832903
  21. The HTR3B rs1176744 gain-of-function Ser129 allele predicted alcohol dependence & was more common in men with alcohol and drug dependence. PMID: 20838391
  22. No associations were found with the 5-HT3B receptor haplotypes and the risk of delayed chemotherapy-induced nausea and vomiting in patients treated with ondansetron and metoclopramide. PMID: 21840870
  23. findings indicate that HTR3A and HTR3B polymorphisms may not play a major role in the susceptibility to suicidal behavior in schizophrenia subjects. PMID: 21184810
  24. Six functional and coding variants of the subunit genes HTR3A, HTR3B as well as the novel HTR3C, HTR3D, and HTR3E subunits in the response to haloperidol or risperidone, were assessed. PMID: 19794330
  25. role of the subunits A and B of the HTR3 receptor using 140 schizophrenia patients taking clozapine for 6 months PMID: 20168265
  26. Cell surface expression of 5-hydroxytryptamine type 3 receptors is controlled by an endoplasmic reticulum retention signal PMID: 12750374
  27. Only 1.3% of antiemetic treatment failure with 5-HT3 receptor antagonists is associated with 5-HT3B receptor gene variant PMID: 12775740
  28. By constructing chimaeric 5-HT3A and 5-HT3B subunits we identified a region (the 'HA-stretch') within the large cytoplasmic loop of the receptor that markedly influences channel conductance PMID: 12867984
  29. 5-HT excited human enteric neurons via 5-HT3 receptors, which may comprise both 5-HT3A and 5-HT3B receptor subunits. PMID: 15887114
  30. Six sequence variants found in Gilles de la Tourette syndrome. PMID: 16314763
  31. Different transcriptional regulation of the HTR3B gene by two alternative promoters in the peripheral and the central nervous system leads to expression of transcripts with variations in the 5' coding sequence. PMID: 17010535
  32. The -100_-102AAG deletion variant of the 5-HT3B receptor gene may affect paroxetine-induced nausea. PMID: 17697394
  33. an HTR3B variant associated with major depression dramatically augments the signaling of the human 5-HT3AB receptor PMID: 18184810
  34. the incorporation of the 5-HT3B subunit leads to spontaneous channel opening and altered ligand properties PMID: 18187416
  35. performed electrophoretic mobility shift and luciferase reporter gene assays to elucidate the effect of this -100_-102delAAG deletion polymorphism on the HTR3B promoter activity in PC-12 and HEK293 cells PMID: 18300944
  36. Variants in the HTR3B gene is associated with psychiatric diseases PMID: 18698232
  37. The results suggest that HTR3B is involved in the development of TRS in the Japanese population. PMID: 18807291
  38. 5-HT3B(I143T)-containing 5-HT3AB receptors display significantly reduced cell surface expression and different signalling properties compared with WT 5-HT3AB receptors. PMID: 19008750
  39. 5-HT3R might contribute to the imbalance between excitation and inhibition that characterize the brain of alcoholics PMID: 19185213
  40. Genetic variations in the HTR3A and HTR3B gene seem to be associated with the individual risk of developing postoperative vomiting. PMID: 19713259
  41. an involvement of serotonin receptor type 3B variants in the aetiopathology of eating disorders in humans. PMID: 19741568
  42. Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 18982004

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Presumably retained within the endoplasmic reticulum unless complexed with HTR3A.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily, HTR3B sub-subfamily
Tissue Specificity
Expressed in the brain cortex, in the caudate nucleus, the hyppocampus, the thalamus and the amygdala. Detected in the kidney and testis as well as in monocytes of the spleen, small and large intestine, uterus, prostate, ovary and placenta.
Database Links

HGNC: 5298

OMIM: 604654

KEGG: hsa:9177

STRING: 9606.ENSP00000260191

UniGene: Hs.241377

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1