Recombinant Human ATP-sensitive inward rectifier potassium channel 15 (KCNJ15)

Code CSB-CF860350HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
KCNJ15
Uniprot No.
Alternative Names
KCNJ15; KCNJ14; ATP-sensitive inward rectifier potassium channel 15; Inward rectifier K(+ channel Kir1.3; Inward rectifier K(+ channel Kir4.2; Potassium channel, inwardly rectifying subfamily J member 15
Species
Homo sapiens (Human)
Expression Region
1-375
Target Protein Sequence
MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLF SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQ RERELRTLLLQQSNV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.
Gene References into Functions
  1. KCNJ15 couples with polyamines in sensing weak electric fields. PMID: 26449415
  2. RNA-seq evidence of biallelic expression of KCNJ15 and 10 neighboring genes in at least one primary human tissue tested indicates that the expression of KCNJ15 is uncoupled from the control of the maternally inherited 5mCpG imprints at the WRB differentially methylated region (DMR) in disomic controls or trisomy (Down syndrome) individuals. PMID: 27100087
  3. KCNJ15 has a major role in histamine-stimulated gastric acid secretion. PMID: 26108660
  4. We had performed a replication study using an independent larger Japanese population for the association of rs3746876 within KCNJ15, and observed a significant association of rs3746876 with type 2 diabetes, but this study failed to find original finding. PMID: 23595124
  5. It was shown that downregulation of Kcnj15 leads to increased insulin secretion in vitro and in vivo. The mechanism for regulating insulin secretion inolved a calcium-sensiong receptor. PMID: 22566534
  6. KCNJ15 is a previously unreported susceptibility gene for T2DM among Asians PMID: 20085713
  7. maintaining electrical integrity of bile-generating hepatocytes. PMID: 11804844
  8. The potential synergy and consequences of the overexpression of KIR4.2 and KIR3.2 in Down's syndrome brain development are discussed. PMID: 15068243
  9. MUPP1 and Kir4.2 may participate in a protein complex in the nephron that could regulate transport of K(+) as well as other ions. PMID: 19420109

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ15 subfamily
Database Links

HGNC: 6261

OMIM: 602106

KEGG: hsa:3772

STRING: 9606.ENSP00000331698

UniGene: Hs.411299

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1