Alternative Names
            
              (ATP synthase membrane subunit f)
             
           
                                        
            Species
            Homo sapiens (Human)
           
                              
                              
                              
            Target Protein
              Sequence            
            MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
              Note: The complete
                sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
                translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
                
If the exact amino acid sequence of this recombinant protein is critical to your application,
                please explicitly request the full and complete sequence of this protein before ordering.
                          
           
                                        
            Protein Length
            Full Length
           
                                        
            Tag Info
            
                                          C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
                          
           
                              
            Form
            
                            Lyophilized powder                             
              Note: We will preferentially ship the format that
                we have in stock, however, if you have any special requirement for the format, please remark your
                requirement when placing the order, we will prepare according to your demand.
                          
           
                    
            Buffer
                          Lyophilized from PBS, 6% Trehalose, pH 7.4.                          
           
                                                  
            Reconstitution
            We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C.
Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
           
                    
                    
            Storage Condition
            Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
              repeated freeze-thaw
              cycles.
           
                              
            Shelf Life
            The shelf life is related to many factors, storage state, buffer ingredients, storage
              temperature
              and the stability of the protein itself.
              Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
              form is 12 months at -20°C/-80°C. 
           
                    
            Lead Time
            Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.            
           
                    
            Notes
            The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
           
                    
            Datasheet & COA
             Please contact us to get it.