Recombinant Human Alpha-2B adrenergic receptor (ADRA2B)

Code CSB-CF001389HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
ADRA2B; ADRA2L1; ADRA2RL1; Alpha-2B adrenergic receptor; Alpha-2 adrenergic receptor subtype C2; Alpha-2B adrenoreceptor; Alpha-2B adrenoceptor; Alpha-2BAR
Species
Homo sapiens (Human)
Expression Region
1-450
Target Protein Sequence
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The rank order of potency for agonists of this receptor is clonidine > norepinephrine > epinephrine = oxymetazoline > dopamine > p-tyramine = phenylephrine > serotonin > p-synephrine / p-octopamine. For antagonists, the rank order is yohimbine > chlorpromazine > phentolamine > mianserine > spiperone > prazosin > alprenolol > propanolol > pindolol.
Gene References into Functions
  1. An exaggerated vasoconstriction response to dexmedetomidine, an alpha-2 adrenergic agonist, has been associated with deletion in the alpha-2B adrenoreceptor gene (ADRA2B deletion). PMID: 28482761
  2. Data indicate an association of arterial stiffness and platelet alpha2B-Rs gene expression. PMID: 28923554
  3. full length alpha2B-AR associated with GGA2 but not GGA1, its third intracellular loop was found to directly interact with both GGA1 and GGA2. More interestingly, further mapping of interaction domains showed that the GGA1 hinge region and the GGA2 GAE domain bound to multiple subdomains of the loop. PMID: 27901063
  4. The ADRA2B DD genotype was associated with Hypertension and was more common in the native population of Mountain Shoria (Siberia). PMID: 29039833
  5. stress administered immediately before learning selectively enhanced long-term recall in ADRA2B deletion carriers. Stress administered 30min before learning impaired recognition memory in male deletion carriers, while enhancing recognition memory in female deletion carriers. PMID: 28254464
  6. This study demonstrated that a deletion variant of the ADRA2B gene encoding the alpha2b-adrenoceptor reduces the stress-induced shift from hippocampal cognitive toward dorsal striatal habit memory. PMID: 28115477
  7. These results identify a beta2-adrenergic-Ca(2+)-actin axis as a new regulator of cell deformability. PMID: 27875276
  8. ADRA2B SNPs were associated with myocardial infarction susceptibility, blood pressure and plasma lipids. PMID: 28456594
  9. These findings suggest that deletion variants of ADRA2B may show greater levels of cognitive-affective flexibility compared to non-carriers. PMID: 26899992
  10. role of GGA3 in the cell surface export of alpha2B-adrenergic receptor PMID: 26811329
  11. Common polymorphisms in the ADRA2B gene are not associated with orthostatic hypotension risk in Chinese. PMID: 26427149
  12. norepinephrine-related neurogenetic differences enhance the subjective vividness of perceptual experience and its emotional enhancement. PMID: 25904801
  13. The results of this study suggested that ADRA2B is closely related to the individual difference in human attention orientation, but not to the individual difference in emotional processing. PMID: 25325286
  14. ADRA2B deletion carriers showed decreased neural activity in the amygdala when recognizing emotional faces in control condition and increased amygdala activity under stress. PMID: 25127926
  15. The ADRA2B deletion variant may selectively predict stress effects on memory in females. PMID: 24997351
  16. Polymorphism DD of a gene ADRA2B is a genetic predictor of predisposition to the blockade of the right and left bundle branch block. PMID: 25558682
  17. Carrying the ADRA2B deletion variant enhances the relationship between arousal at encoding and subsequent memory for moderately arousing events. PMID: 24149058
  18. ADRA2B mutations are associated with emotional subjectivity of viusal perception. PMID: 24058067
  19. The ADRA2b deletion variant, which was previously associated with vasoconstriction, to emotional memory and visual perception. PMID: 24269973
  20. A mutation in alpha2B-adrenergic receptor is associated with autosomal dominant cortical myoclonus and epilepsy. PMID: 24114805
  21. Carriers of the ADRA2B functional deletion variant showed an impaired recognition and slower retrieval of neutral faces under stress. PMID: 23583499
  22. Statistically significant prevalence of homozygous genotype DD of ADRA2B gene was found in patients with atrioventricular blocks and sick sinus node syndrome. PMID: 24087960
  23. this study demonstrated for the first time an independent contribution of the ADRA2B genetic polymorphism to memory impairment and we further suggest a possible protective role of the deletion variant against the disease development. PMID: 23499426
  24. Adenosine alpha2B receptor is upregulated in the peripheral blood leukocytes of multiple sclerosis patients. PMID: 23225885
  25. Molecular dynamics simulations of palmitoylated/glycosylated, membrane-integrated human A(2B)AR in its native environment is a possible approach and this model can be used for designing potent and selective A(2B)AR antagonists. PMID: 22570080
  26. There were no main effects or interactions in relation to ADRA2B genotype. PMID: 21965191
  27. The significant novel finding from this study is that the affective modulation of T2 detection is influenced by a non-additive (epistatic) interaction between the ADRA2B and 5-HTTLPR insertion/deletion polymorphisms. PMID: 21854681
  28. Adenosine A(2B) receptor signaling plays a role in regulating placental 11beta-hydroxysteroid dehydrogenase type 2 expression, and consequently fetal development. PMID: 22701600
  29. Activation of the adenosine A(2B) receptor protects against vascular injury, while it also enhances plaque stability as indicated by increased collagen content. PMID: 22743060
  30. A triple arg motif mediates alpha(2B)-adrenergic receptor interaction with Sec24C/D and export PMID: 22404651
  31. For the first time, we revealed on clinical - genetic material association between hereditary disturbances of cardiac conduction and polymorphism of 2-adrenergic receptor gene. PMID: 22839581
  32. this study found significant effects of ADRA2B haplotype polymorphisms on response inhibition in a large Chinese sample, with the minor AAGG haplotype associated with shorter SSR. PMID: 22218095
  33. Data strongly demonstrate that the small GTPase ARF1 modulates ERK1/2 activation by alpha(2B)-AR and provide the first evidence indicating a novel function for ARF1 in regulating the MAPK signaling pathway. PMID: 22025613
  34. the ADRA2B polymorphism influences emotional memory formation but not memory retrieval in the amygdala and left inferior frontal gyrus. PMID: 21259387
  35. The noradrenaline-mediated depolarization of vascular smooth muscle cells is produced by activation of both alpha(1)-and alpha(2)-adrenoceptors. PMID: 20739228
  36. Was detected polymorphisms of ADRA2B in patients with atrial fibrillation. PMID: 21942960
  37. ADRA2B gene polymorphism might be associated with the hereditary sick sinus node syndrome. PMID: 21878072
  38. Data do not show any association between the presence of the alpha2B-adrenergic receptor deletion allele and the occurrence of spontaneous abortions. PMID: 21159032
  39. Alpha2B-adrenergic receptor interaction with tubulin controls its transport from the endoplasmic reticulum to the cell surface PMID: 21357695
  40. gene x exercise interactions were observed for A2BGlu9/12 and B2Gln27Glu on change in lean soft tissue (LST, p = 0.02); exercisers on the A2BGlu9- background gained LST compared to a loss among controls over 12 months (p\0.05) PMID: 20401689
  41. Homozygote for insertion [I]/deletion allele of alpha(2B)-AR gene polymorphism is associated with silent myocardial ischemia in type 2 diabetes mellitus patients with coronary artery disease. PMID: 20692245
  42. the findings of this study do not support a functional significance of ADRA2B indel polymorphism at position -4825 relative to the start codon in the far upstream region of the promoter in the present migraine subjects. PMID: 20651814
  43. Data provide strong evidence indicating that Rab8 GTPase interacts with distinct motifs in the C termini of alpha(2B)-AR and beta(2)-AR and differentially modulates their traffic from the TGN to the cell surface. PMID: 20424170
  44. carriage of the ADRA2B deletion abolished the relative memory impairment in homozygous COMT val158 carriers compared to met158 carriers. PMID: 20110158
  45. The ADRA2B 301-303 deletion allele (ins/del and del/del, n = 18) was associated with resistance to desensitization. PMID: 20051907
  46. Middle-aged white men carrying the DD genotype of the alpha(2B)-AR have a significantly increased risk for sudden cardiac death and myocardial infarction, especially before the age of 55 years. PMID: 12535806
  47. No major functional significance of the alpha(2B) adrenergic receptor polymorphism in the present sample of morbidly obese subjects was found. PMID: 12822042
  48. A polymorphism in the (alpha)2B adrenoceptor gene associates with hypertension. PMID: 14744925
  49. body fat response to exercise training in older adults is associated with the combined effects of the Glu12/Glu9 alpha2b-adrenergic receptor, Trp64Arg beta3-adrenergic receptor, and Gln27Glu beta2-adrenergic receptor gene variants PMID: 15166301
  50. The 12Glu9 polymorphism of ADRA2B is associated with impaired insulin secretion and may predict the development of Type 2 diabetes. PMID: 15309292

Show More

Hide All

Involvement in disease
Epilepsy, familial adult myoclonic, 2 (FAME2)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2B sub-subfamily
Database Links

HGNC: 282

OMIM: 104260

KEGG: hsa:151

STRING: 9606.ENSP00000387281

UniGene: Hs.247686

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1