Recombinant Human Blood vessel epicardial substance (BVES)

Code CSB-CF002887HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
BVES
Uniprot No.
Alternative Names
BVES; POP1; POPDC1; Blood vessel epicardial substance; hBVES; Popeye domain-containing protein 1; Popeye protein 1
Species
Homo sapiens (Human)
Expression Region
1-360
Target Protein Sequence
MNYTESSPLRESTAIGFTPELESIIPVPSNKTTCENWREIHHLVFHVANICFAVGLVIPT TLHLHMIFLRGMLTLGCTLYIVWATLYRCALDIMIWNSVFLGVNILHLSYLLYKKRPVKI EKELSGMYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGK MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLE SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS DSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. Plays a role in VAMP3-mediated vesicular transport and recycling of different receptor molecules through its interaction with VAMP3. Plays a role in the regulation of cell shape and movement by modulating the Rho-family GTPase activity through its interaction with ARHGEF25/GEFT. Induces primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. Also involved in striated muscle regeneration and repair and in the regulation of cell spreading. Important for the maintenance of cardiac function. Plays a regulatory function in heart rate dynamics mediated, at least in part, through cAMP-binding and, probably, by increasing cell surface expression of the potassium channel KCNK2 and enhancing current density. Is also a caveolae-associated protein important for the preservation of caveolae structural and functional integrity as well as for heart protection against ischemia injury.
Gene References into Functions
  1. Functional suppression of POPDC1 promoted breast cancer cell migration and proliferation, cAMP interacts with POPDC1 and up-regulates its expression in breast cancer cells. PMID: 28954821
  2. recently a novel family of cAMP effector proteins emerged and was termed the Popeye domain containing (POPDC) family, which consists of three members POPDC1, POPDC2 and POPDC3. POPDC proteins are transmembrane proteins, which are abundantly present in striated and smooth muscle cells. POPDC proteins bind cAMP with high affinity comparable to PKA PMID: 28939104
  3. Study shows that EGFR negatively regulates POPDC1 expression in breast cancer cell lines and that overexpression of POPDC1 can reduce EGFR-mediated cell migration and proliferation in breast cancer cells. PMID: 28807821
  4. BVES plays a key role in maintaining the integrity of the colonic mucosa and protecting from inflammatory carcinogenesis. Results also suggest that BVES promotes the post-translational degradation of c-Myc. PMID: 28389570
  5. Forced expression of POPDC1(S201F) in a murine cardiac muscle cell line (HL-1) increased hyperpolarization and upstroke velocity of the action potential PMID: 26642364
  6. These results suggest that down-regulation of BVES in hepatocellular carcinoma induces epithelial-mesenchymal transition, thus promoting invasion and metastasis in HCC cells. PMID: 24442236
  7. Coding sequence and splice junctions of BVES were sequenced in 114 unrelated patients with Tetralogy of Fallot and 400 unrelated healthy individuals.Four novel BVES mutations were identified in patients with TOF but not in the 400 controls. PMID: 23403794
  8. Popdc1 (Bves) modulates cardiac pacemaker activity in response to stress and displays high expression levels in the sinus node. The Popeye domain acts as a high-affinity cAMP binding domain and Popdc proteins interact with the ion channel TREK-1. PMID: 22354168
  9. Low Bves expression is associated with gastric cancer progression. PMID: 22109561
  10. BVES was found to be underexpressed in all stages of colorectal carcinoma and in adenomatous polyps, indicating its suppression occurs early in transformation. PMID: 21911938
  11. Bves expression and localization can regulate RhoA and ZONAB/DbpA activity. PMID: 21283798
  12. Data suggest that POPDC gene expression is modified in end-stage heart failure in humans in a manner suggesting regulatory and/or functional differences between the three family members and that POPDC1 is particularly susceptible to this condition. PMID: 21069264
  13. Frequent silencing of BVES is associated with promoter hypermethylation in gastric cancer. PMID: 20627872
  14. Methylation of BVES was present in 80% of NSCLC tissues but only 14% of noncancerous tissues. PMID: 18349282

Show More

Hide All

Involvement in disease
Limb-girdle muscular dystrophy 2X (LGMD2X)
Subcellular Location
Lateral cell membrane. Cell junction, tight junction. Membrane; Multi-pass membrane protein. Cell membrane, sarcolemma. Membrane, caveola.
Protein Families
Popeye family
Tissue Specificity
Expressed in epithelial cells (at protein level). Expressed in fetal and adult heart and skeletal muscle.
Database Links

HGNC: 1152

OMIM: 604577

KEGG: hsa:11149

STRING: 9606.ENSP00000313172

UniGene: Hs.221660

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1