Recombinant Human Bombesin receptor-activated protein C6orf89 (C6orf89)

Code CSB-CF764939HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
C6orf89
Uniprot No.
Alternative Names
C6orf89; BRAP; UNQ177/PRO203; Bombesin receptor-activated protein C6orf89; Amfion
Species
Homo sapiens (Human)
Expression Region
1-347
Target Protein Sequence
MDLAANEISIYDKLSETVDLVRQTGHQCGMSEKAIEKFIRQLLEKNEPQRPPPQYPLLIV VYKVLATLGLILLTAYFVIQPFSPLAPEPVLSGAHTWRSLIHHIRLMSLPIAKKYMSENK GVPLHGGDEDRPFPDFDPWWTNDCEQNESEPIPANCTGCAQKHLKVMLLEDAPRKFERLH PLVIKTGKPLLEEEIQHFLCQYPEATEGFSEGFFAKWWRCFPERWFPFPYPWRRPLNRSQ MLRELFPVFTHLPFPKDASLNKCSFLHPEPVVGSKMHKMPDLFIIGSGEAMLQLIPPFQC RRHCQSVAMPIEPGDIGYVDTTHWKVYVIARGVQPLVICDGTAFSEL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Exhibits histone deacetylase (HDAC) enhancer properties. May play a role in cell cycle progression and wound repair of bronchial epithelial cells.
Gene References into Functions
  1. results suggest BRAP plays an important role in airway inflammation and its overexpression may regulate NE-induced MUC5AC hypersecretion in HBE16 cells via the EGFR/ERK/NF-kappaB signaling pathway PMID: 28476309
  2. Data show that BRAP locates in the membrane and cytoplasm, suggesting that this protein is a cytoplasm protein, which promotes cell cycle and wound repair of HBECs. PMID: 21857995
  3. Data indicate that bombesin receptor-activated protein (BRAP) might increase histone deacetylases 1/2 (HDAC) activity that leads to NF-kappa B (NF-kappaB) activation via its putative C-terminal domain. PMID: 26460487
  4. C60rf89 is a gene that encodes three distinct proteins with the capacity to enhance the activity of histone deacetylases (HDACs) in the nucleolus, the Golgi and the midbody PMID: 23460338
  5. C6orf89 encodes one soluble and two type II membrane proteins that function as histone deacetylase enhancers. The 34sp is selectively targeted to the nucleolus and is retained in nucleolar organizer regions in mitotic cells. The 34sp is integrated into the ribosomal gene transcription machinery and is relocalized to the nucleolus upon the arrest of rDNA transcription, protein synthesis, and PI3K/mTORC signalling. PMID: 23460338
  6. Overexpression of BRAP may play a role during the antigen presenting process of bronchial epithelium by inhibiting the antigen uptake ability of bronchial epithelial cells. PMID: 22930588

Show More

Hide All

Subcellular Location
[Isoform 1]: Golgi apparatus membrane; Single-pass type II membrane protein. Midbody.; [Isoform 2]: Golgi apparatus membrane; Single-pass type II membrane protein. Midbody.; [Isoform 3]: Cytoplasm. Nucleus, nucleolus.
Database Links

HGNC: 21114

OMIM: 616642

KEGG: hsa:221477

STRING: 9606.ENSP00000347322

UniGene: Hs.433381

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1