Recombinant Human C-C chemokine receptor type 5(CCR5)

Code CSB-CF004844HU
Size US$3468
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names CCR5
Uniprot No. P51681
Research Area Cancer
Alternative Names AM4 7; C C chemokine receptor type 5; C C CKR 5; C-C chemokine receptor type 5; C-C CKR-5; C-C motif chemokine receptor 5 A159A ; CC Chemokine Receptor 5; CC Chemokine Receptor Type 5; CC CKR 5; CC-CKR-5; CCCKR 5; CCCKR5; CCR 5; CCR-5; CCR5; CCR5 chemokine (C C motif) receptor 5; CCR5_HUMAN; CD 195; CD195; CD195 Antigen; Chemokine C C motif receptor 5; Chemokine receptor CCR5 ; CHEMR13; CKR 5; CKR5; CMKBR 5; CMKBR5; FLJ78003 ; HIV 1 Fusion Coreceptor; HIV-1 fusion coreceptor; HIV1 fusion coreceptor; IDDM22 ; MIP-1 alpha receptor
Species Homo sapiens (Human)
Source in vitro E.coli expression system
Expression Region 1-352aa
Target Protein Sequence MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 43.9 kDa
Protein Length Full Length
Tag Info N-terminal 10xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 R5 isolates.
Gene References into Functions
  1. Conditioned media or microparticles released from obese omental adipose tissue increased CD16 and CCR5 expression on CD14(+)CD16(-) monocytes and augmented their migratory capacity towards the conditioned media from obese omental adipose tissue, itself. PMID: 27677832
  2. The block of the protein kinases phosphorylation mediated by staurosporine treatment abrogates the capture of the chemokine receptor CCR5 (CCR5) signalosome into the early endosomes. This suggests the relevant role of phosphorylation events to form steady receptor-beta-arrestin2 complexes, mediated by an ubiquitination of beta-arrestin2 and a durable phosphorylation of ERK1, which are concentrated into the early endoso... PMID: 29283386
  3. data suggests that the exposure of myeloid cells to Meth in the context of presence of HIV peptides such as Tat, may affect the number of HIV targets by modulating CCR5 expression, through a combination of DA-dependent and-independent mechanisms. PMID: 29944719
  4. We use CPRC prostate cancer model and demonstrate that endothelial cells secrete large amount of CCL5 and induces autophagy by suppressing AR expression in prostate cancer cell lines. Consequently, elevated autophagy accelerates focal adhesions proteins disassembly and promoted prostate cancer invasion. Inhibition of both CCL5/CCR5 signaling and autophagy significantly reduces metastasis in vivo PMID: 30200999
  5. Data provides evidence that CCR5 has an essential role in bone-destructive conditions through the functional regulation of osteoclasts. PMID: 29263385
  6. A critical role for CCR5 in recruitment and activation of myeloid-derived suppressor cells in melanoma microenvironment. PMID: 29089297
  7. these findings emphasize the potential involvement of CCR5 signaling in central nervous system inflammation and damage in multiple sclerosis PMID: 29729320
  8. As patients with and without CCR5Delta32 mutations were similar in terms of histological activity (p = 0.84) and fibrosis stage (p = 0.20) as well as CCR5 tissue expression, the authors reasonably exclude that this CCR5 mutation is significantly involved in the pathogenesis of chronic hepatitis C. PMID: 29664712
  9. This study demonstrates that, CCR5 promoter polymorphisms correlate with CD4 T cell loss possibly by regulating CD4 T cell apoptosis in HIV patients. PMID: 28331180
  10. Results suggest that monocytes from Crohn's disease patients in remission produced high levels of CSF-1 that upregulate CCR5 expression. Consequently, monocytes differentiated in these conditions had a characteristic phenotype and lower production of inflammatory cytokines. PMID: 28273887
  11. The findings provide genetic and epidemiological evidence for an association of UGT1A and CCR5 polymorphisms with hepatitis B virus infection in Chinese Yi and Yao populations. PMID: 29239247
  12. Authors also demonstrated that Treg migration to the tumor microenvironment is mediated by CCR5, and these cells are promoting tumor growth via inhibition of antitumor cells such as cytotoxic CD8(+) T cells. PMID: 28904130
  13. These data indicate that cardiac surgery influences the expression of CD162, CD166 and CD195 and that the intensity of the immune system response, displayed as the change in the CD162, CD166, CD195 expression, varies, depending on the surgical technique used. PMID: 27625334
  14. the interaction between CCR5 and its ligands promotes the proliferation of CCR5(+) polymorphonuclear-myeloid-derived suppressor cells at the bone marrow PMID: 29166611
  15. CCR5Delta32 allele is not associated with susceptibility to HIV-1 infection in Iranian population. PMID: 29209099
  16. engineered CCR5Delta32/Delta32 mutations endowed CD4+ U87 cells with resistance against HIV1 infection; this sitespecific, sizecontrolled and homozygous DNA deletion technique was able to induce precise genomic editing PMID: 29115572
  17. KLF5-regulating cancer-associated fibroblasts affect gastric cancer cells progression by CCL5 secretion and activation of CCR5. PMID: 28934010
  18. CCR5Delta32 mutation is not associated with acute graft-versus-host disease. PMID: 28862353
  19. CCR5 is involved but also to generate new antidody-based therapeutics. PMID: 28008933
  20. These results confirm the protective role of CCR5Delta32, and extend it to the long-term survival in a large cohort of HIV-infected patients. Beyond its antiviral effect, CCR5Delta32 enhanced the long-term survival of patients on cART. PMID: 29221798
  21. This study showed that individuals with the CCR5/CCR5 genotype and simultaneously the CCR5-59029 AA or AG genotypes have a greater risk of developing ocular toxoplasmosis, which may be associated with a strong and persistent inflammatory response in ocular tissue. PMID: 29221851
  22. the protective CCR5-Delta32 allele appears to be rarely present in Saudi Arabia. PMID: 28731615
  23. these data highlight the important role of CCR5 in the onset of acute coronary syndrome and suggest this receptor as a marker of cardiovascular risk PMID: 28276569
  24. we observed an overall protective effect associated to the presence of the CCR5Delta32 allele against RA susceptibility that was evidenced in cities with a lower African genetic component. Our results highlight the importance of assessing the influence of CCR5 under different genetic backgrounds. PMID: 28082621
  25. results suggest that the CCR5 gene and its product might play a role in the pathogenesis of Crimean-Congo hemorrhagic fever infection PMID: 28547880
  26. the interplay between chemokine receptor CCR5 expression, cancer stem cells, and hypoxia PMID: 28693495
  27. genetic association studies in population in Poland: Data suggest that CCR5-delta32 gene polymorphism is associated with type 1 diabetes (T1D) and increases risk of celiac disease and autoimmune thyroid disorders in patients with T1D; risk of celiac disease or autoimmune thyroiditis in carriers of 32-bp deletion is more than threefold higher than for non-carriers. PMID: 27894748
  28. differential distribution of the viral reservoir compartment in CCR5((WT/Delta32)) patients with perinatal HIV infection PMID: 28042001
  29. The donor CCR5 -2086A/A genotype was associated with a lower incidence of grades 3-4 acute GVHD, which did not improve the survival outcomes. These findings suggest that the recipient CCR5 -2086A/A genotype affects the induction of the graft-versus-tumor effect without augmenting the development of GVHD. PMID: 28487238
  30. searched for the relationship between single nucleotide polymorphism in the promoter region of the CD209, IL-10, IL-28 and 32 base pair deletion in CCR5 coding region (Delta 32) with the human predisposition to development of various clinical presentations of tick-borne encephalitis PMID: 28894041
  31. Deficiency of CCR5 exacerbates alcoholic fatty liver disease by hepatic inflammation induced by pro-inflammatory cytokines and chemokines and oxidative stress. PMID: 27859576
  32. rs1800024 polymorphism significantly associated with occurrence risk of psoriasis vulgaris in Chinese population PMID: 29145242
  33. CCR5-tropic HIV infection is limited to more differentiated progenitor cells with life spans that are less well understood. PMID: 28732051
  34. Data provide evidence that CCR5 activation mediates CCL5 enhances the proliferation and the invasive capacity of human breast cancer cell lines. PMID: 27335323
  35. CCR5-Delta32 polymorphism is associated with type 1 diabetes. PMID: 27619405
  36. CCR52 genetic variants were not associated with risk of atherosclerotic coronary heart disease and glucometabolic traits PMID: 27013693
  37. No sickle cell disease patients presented CCR5Delta32 deletion. PMID: 28671257
  38. this review discusses the role of CCR5 in recruitment and activation of myeloid-derived suppressor cells in melanoma PMID: 28382399
  39. CCR5 is highly expressed in active inflammatory bowel disease, and it has positive correlation with lymphocyte grade and negative correlation with expression of beta-arrestin2. PMID: 28140695
  40. this study shows that the dominant signature of resistance to HIV infection in this cohort of exposed but uninfected individuals was lower T-cell CCR5 expression PMID: 28398593
  41. the level of IFNAR1, IFNAR2, and CCR5 mRNA expression was found to be significantly lower in the responders than nonresponders.Our results highlighted the significance of IFNAR and CCR5 genes in multiple sclerosis risk and the response to IFN-b therapy. PMID: 27346865
  42. Env regions that respond to CCR5 binding was located in the gp120 alpha1 helix and in the gp41 HR1 heptad repeat and membrane-proximal external region. PMID: 28521215
  43. A frameshift mutation in CCR5 was associated, but not significantly, with sporadic inclusion body myositis. PMID: 28086002
  44. study revealed that while HIV-1 gp120 and Staph aureus LukED both target CCR5, they bind to different regions of the receptor, highlighting the divergence of the pathogens PMID: 27965453
  45. Genetic variation of CCR5 gene demonstrates a possible association with hypertension, diabetes mellitus and atherosclerosis comorbidity in patient treated with hemodialysis. PMID: 27118566
  46. Findings indicate the importance of chemokine (CC motif) ligand 5 (CCL5) genetic variability and CCL5-CCR5 (CC chemokine receptor 5) axis on the susceptibility to HCV. PMID: 27304910
  47. The transferred nuclear Overhauser effect (TRNOE) crosspeaks in the ternary complex were assigned to the specific Tyr protons in the human C-C chemokine receptor 5 (CCR5) chemokine receptor peptide and to methyl protons, predominantly of isoleucine residues, and also of leucine and/or valine residues of HIV-1 gp120 envelope protein. PMID: 27701820
  48. Intermolecular interactions of RANTES with its receptor CCR5 have been reported based on NMR spectroscopy measurements. PMID: 28052516
  49. Binding of J113863 to CCR2 or CCR5 also induced the recruitment of beta-arrestin 2, whereas UCB35625 did not. UCB35625 induced the chemotaxis of L1.2 cells expressing CCR2 or CCR5. In contrast, J113863 induced the migration of L1.2-CCR2 cells but antagonized the chemokine-induced migration of L1.2-CCR5 cells. PMID: 27895119
  50. The higher frequency of CCR5 wild-type allele among leishmaniasis patients may suggest an increased risk of HIV infection and also support its facilitative role in Leishmania infection PMID: 26970327
  51. CCR5 is reduced following low-intensity strength exercise with blood flow restriction. PMID: 25643617
  52. Macrophages promote glioblastoma cell invasion by the CCL4-CCR5 axis, and hypoxia enhances the interaction between these two types of cells by upregulating both CCL4 and CCR5 expression, respectively. PMID: 27748906
  53. ACE I/D is associated with Abdominal Aortic Aneurysm , and 1166A>C AT1R with the size of the aneurysm, while -1562C>T MMP-9 and CCR5Delta32 polymorphisms are most probably not associated with Abdominal Aortic Aneurysm in Croatian patients. PMID: 27533781
  54. There were no associations of CCL5 gene promoter polymorphism with the risk of diabetic microvascular complications (DMI); However, the 59029A polymorphism in CCR5 might affect individual susceptibility for DMI [Meta-Analysis] PMID: 27042273
  55. the CXCR3+/CCR5+ expression was higher in the neoplastic as compared to the hyperplastic nodules. PMID: 27872865
  56. Data suggest that gene therapy that only targets the CC Chemokine Receptor 5 (CCR5) co-receptor fails to suppress HIV-1. PMID: 26674113
  57. The authors provide the first evidence that shows CCR5 interaction with a dual-tropic HIV-1 Env played a significant role in Env-induced depletion of CD4 T cells. PMID: 27026376
  58. Data indicate that on addition of the heat-shock proteins GroEL-GroES molecular chaperone system, the folding of the nascent chemokine receptor type 5 (CCR5) was significantly enhanced. PMID: 26585937
  59. CCR5Delta32 polymorphism might be associated with systemic lupus erythematosus genetic predisposition among female Brazilian patients and the age at onset of the disease; however, this genetic variant was not associated with the activity of SLE PMID: 26071874
  60. The results of this study infer CCR5 and CCL5 participate in the response to tick-borne encephalitis virus, as well as to other neurotropic pathogens. PMID: 26906062
  61. Enhanced susceptibility of activated endocervical CD4+ T cells to HIV may be related to increased CCR5 expression by these cell subsets, but did not appear to be due to direct interaction of integrins a4b7 or a4b1 with HIV envelope. PMID: 25872482
  62. individuals carrying heterozygous or homozygous genotypes (GA+AA) for CCR2-64I polymorphisms seem to be at lower risk for cervical lesion [odds ratio (OR) = 0.37, p = 0.0008)]. The same was observed for the A allele (OR = 0.39, p = 0.0002), while no association was detected (p > 0.05) with CCR5-Delta32 polymorphism. PMID: 26982176
  63. Study provides the evidence that the chemokine receptor CCR5 is highly expressed and associated with poor prognosis in human glioblastoma. Mechanistically, CCL5-CCR5 mediates activation of Akt, and subsequently induces proliferation and invasive responses in U87 and U251 cells. PMID: 26390883
  64. CCR5-Delta32 polymorphism is associated with susceptibility to cancer. PMID: 25203595
  65. The relationship between CCR5 variation, HIV-1 reservoir size, lymphocyte activation, and CCR% expression in patients receiving ant-HIV therapy is reported. PMID: 26512140
  66. the CCR5Delta32 polymorphism does not seem to influence the different clinical manifestations of Chagas disease but there is involvement of the CCR5 59029 A/G polymorphism in susceptibility to the different forms of chronic Chagas disease. PMID: 26599761
  67. concluded that CCR5-peptidoliposomes increase the efficiency of sCD4 to inhibit HIV infection by acting as bait for sCD4-primed virus, catalyzing the premature discharge of its fusion potential PMID: 26629902
  68. no anti-HIV positive individuals were found among surgical staff, one in one hundred were resistant to HIV infection. PMID: 27139347
  69. carriers of the CCR5-Delta32 deletion had normal CRP levels but a borderline significant increased risk of cardiovascular diseases. PMID: 26222902
  70. single nucleotide polymorphism of CCL5-403 G substitution by A may play a role in generalized aggressive periodontitis, however, the CCR5Delta32 polymorphism may not. PMID: 25119558
  71. study found the p.L55Q mutation in the N-terminal protein domain was observed only in HIV-1 uninfected individuals, with an allelic frequency of 1.8%; results from physicochemical analysis and modeling suggest that the p.L55Q mutation might alter CCR5 conformation PMID: 25825809
  72. AEG-1 mediates CCL3/CCR5-induced EMT development via both Erk1/2 and Akt signaling pathway in CM patients, which indicates CCL3/CCR5-AEG-1-EMT pathway could be suggested as a useful target to affect the progression of CM. PMID: 26134542
  73. Although susceptibility to infections cannot be completely dependent on one or few genetic variants, it is important to remember that SDF-1 and CCR5 variants have been correlated globally with HIV-1 infection PMID: 26096543
  74. The success of CCR5 antagonist-based therapy. PMID: 26055363
  75. The CCR5delta32 allele appears to be associated with a decreased rate of spontaneous HCV eradication, but not with hepatitis progression or response to antiviral therapy. PMID: 25191700
  76. The Delta32 deletion in the CCR5 gene is not associated with an unfavorable outcome in patients infected with Influenza A(H1N1)pdm09 in the Brazilian admixed population. PMID: 26223981
  77. The present work provides insights into the blocking mechanism of HIV-1 by CCL5. PMID: 24965094
  78. Blocking the CCR5 by maraviroc induces significant cytotoxic and apoptotic effects. PMID: 25840792
  79. we did not observe any difference in the allele frequency of Delta32 allele in esophageal cancer patients and control group, CCR5Delta32 deletion may not be associated with risk to esophageal cancer in the studied population. PMID: 26028088
  80. we combine the live-cell-based SELEX with high-throughput sequencing technology to generate CCR5 RNA aptamers PMID: 25754473
  81. Hormonal contraceptive use in at-risk, HIV-uninfected women was associated with greater surface expression of CD4, CCR5, or CXCR4. PMID: 25895986
  82. Meta-analysis: suggest CCR5Delta32 polymorphism does not have a role in Behcet's disease. PMID: 26393284
  83. methylation content of CCR5 cis-regions is a central epigenetic determinant of T-cell CCR5 levels, and possibly HIV-related outcomes PMID: 26307764
  84. This study reveled that CCR5 having a central role in the bipolar disease and schizophrenia manifestation. PMID: 25487697
  85. Inhibition of HIV-1 infection of primary CD4+ T-cells by knockout expression of CCR5 gene. PMID: 25854553
  86. The results of the osteomyelitis study, although without statistical significance, suggest that the presence of the CCR5Delta32 allele could be associated with protection against osteomyelitis caused by S. aureus. PMID: 25638273
  87. Studied a large number of healthy blood donors from Northern Baden-Wuerttemberg and found an allelic frequency of 9.21 % of the CCR5-delta32 deletion. PMID: 25807520
  88. CCR5 deficiency predisposes patients to fatal outcome in influenza H1N1 infection. PMID: 25918237
  89. Coreceptor switch from CCR5 to CXCR4 is associated with HIV disease progression. PMID: 25032817
  90. HIV-1 Nef, a key factor for viral pathogenesis, downregulates functionally important molecules from the surface of infected cells, including the viral entry receptor CD4 and coreceptors CCR5 and CXCR4. PMID: 26178998
  91. HIV affects -directly or indirectly- the expression of CCR5 in CD4(+) T-lymphocytes. PMID: 25495598
  92. findings indicate that the regulation of CCR5 is highly specific to cell type and provide a potential explanation for the observation that native chemokines are less-effective HIV-entry inhibitors on macrophages compared with T lymphocytes PMID: 25957306
  93. These data bring new insights on the association between viral infections and the chemokine receptor CCR5. PMID: 25939314
  94. CCR5 Delta32 might play a role in lupus nephritis susceptibility in the Chinese population with Han ethnicity (Meta-Analysis) PMID: 24720467
  95. There was no association between the CCR5 deletion32 allele and multiple sclerosis among the Hungarian and Serbian patients. PMID: 25500253
  96. This meta-analysis demonstrates that the CCR5-Delta32 polymorphism is associated with Kawasaki disease, but does not facilitate susceptibility to systemic lupus erythematosus, lupus nephritis, or primary Sjogren's syndrome. PMID: 24599359
  97. Polymorphisms in the HIV gp120 bridging sheet enhanced gp120-CCR5 interactions, thereby promoting infection of brain. PMID: 25797607
  98. The results confirm that variants of CCR5 and CCR2 genes and their haplotypes are associated with the severity but not with susceptibility to develop chagasic cardiomyopathy. PMID: 25312802
  99. There is no significant association between the CCR5 32 base pair deletion mutation and sickle cell disease in a Brazilian population. PMID: 25548430
  100. A sequence comparison of CCR5 and CCR2b identified a divergent amino acid sequence located at the junction of transmembrane domain V and second extracellular loop. PMID: 25767113

Show More

Hide All

Involvement in disease Diabetes mellitus, insulin-dependent, 22 (IDDM22)
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Highly expressed in spleen, thymus, in the myeloid cell line THP-1, in the promyeloblastic cell line KG-1a and on CD4+ and CD8+ T-cells. Medium levels in peripheral blood leukocytes and in small intestine. Low levels in ovary and lung.
Database Links

HGNC: 1606

OMIM: 601373

KEGG: hsa:1234

STRING: 9606.ENSP00000292303

UniGene: Hs.450802

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1