Recombinant Human CD83 antigen (CD83)

Code CSB-CF004962HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CD83; CD83 antigen; hCD83; B-cell activation protein; Cell surface protein HB15; CD antigen CD83
Species
Homo sapiens (Human)
Expression Region
20-205
Target Protein Sequence
TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
Gene References into Functions
  1. the presence of CD83 in mDC membranes enhances T lymphocyte proliferation by boosting calcium release from intracellular stores in these cells. PMID: 24436459
  2. this study shows that the tolerogenic mechanism of action of sCD83 to be dependent on initial interaction with antigen-presenting cells, altering early cytokine signal pathways and leading to T cell unresponsiveness PMID: 28193829
  3. this study shows differential expression and function of CD83 on human immune cells, and reveals potential new roles for this molecule as a target of therapeutic manipulation in transplantation, inflammation, and autoimmune diseases PMID: 27837105
  4. We conducted a genome-wide association study (GWAS) of plasma caffeine, paraxanthine, theophylline, theobromine and paraxanthine/caffeine ratio. A single SNP at 6p23 (near CD83) and several SNPs at 7p21 (near AHR), 15q24 (near CYP1A2) and 19q13.2 (near CYP2A6) met GW-significance (P < 5 x 10-8) and were associated with one or more metabolites PMID: 27702941
  5. Crystal structure of human CD83 reveals that its surface domain consists of an Ig-like domain only.CD83 exerts its immunological activity by mixed homotypic and heterotypic interactions as typically observed for proteins present in the immunological synapse. PMID: 28315353
  6. this study shows that dendritic cells from rheumatoid arthritis patients have low expression levels of CD83 PMID: 27421624
  7. Triple costimulation via CD80, 4-1BB, and CD83 ligand elicits the long-term growth of Vgamma9Vdelta2 T cells in low levels of IL-2. PMID: 26561569
  8. nonspreading Rift Valley fever virus infection of monocyte-derived immature denditic cells results in incomplete maturation, associated with gradual downregulation of CD83. PMID: 26575844
  9. Sustained expression of CD83 was observed when CD4+ T cells were induced by transforming growth factor-beta to differentiate into CD4+CD25+ forkhead box P3+ regulatory T (iTreg) cells. PMID: 25997495
  10. These results suggest that HTLV-I induces CD83 expression on T cells via Tax1 -mediated NF-kappaB activation, which may promote HTLV-I infection in vivo. PMID: 26129803
  11. CD83(+) T cells share important features with regulatory T cells, identifying CD83 as a novel lineage marker to discriminate between different T cell populations. PMID: 25151500
  12. GRASP55 interacts with CD83 shortly after induction of dendritic cells maturation and that this interaction plays a role in CD83 glycosylation as well as in surface expression of CD83 on dendritic cells. PMID: 25701785
  13. suggesting that a negative feedback regulation may exist in monocyte differentiation into dendritic cells (DCs) based on sCD83 released from the mature DCs PMID: 25243645
  14. IDO and CD83 are expressed differently in human epidermal Langerhans cells PMID: 24268989
  15. HSV-1 ICP0 alone induces CD83 degradation independent of its E3 ubiquitin ligase function and of the ubiquitin machinery. PMID: 24643878
  16. Data indicate that the frequencies of CD11c, CD11c/CD86, HLA-DR/CD86, CD83 and CD80 were significantly high, while CD11c/HLA-DR was low in Hepatitis E infection. PMID: 23246582
  17. We identified IRF-1, IRF-2, IRF-5, p50, p65, and cRel to be involved in regulating maturation-specific CD83 expression in DCs. PMID: 23339870
  18. Results do not suggest that the common genetic variation of CD83 is related to cervical or vulvar cancers. The association between tagSNP rs853360 and risk of cervical SCC is likely to be due to chance. PMID: 22134374
  19. CD83-stimulated monocytes suppress T-cell immune responses through production of prostaglandin E2 PMID: 22065790
  20. Suggest that impaired immune function, absence of CD83-positive mature and activated dendritic cells in cancer nodules may have a role in the pathogenesis of thyroid papillary carcinoma. PMID: 21469977
  21. No CD83-positive Langerhans cells were detected in any epidermodysplasia verruciformis patients or normal controls. PMID: 19317050
  22. Human solublee CD83 alone is capable of inducing kidney allograft tolerance in kidney transplantation in mice. PMID: 21076370
  23. Structure identification of recombinant CD83 mutant variant as a potent therapeutic protein is reported. PMID: 20566323
  24. sCD83 is capable of attenuating dendritic cell maturation and function, and inducing donor-specific allograft tolerance, in the absence of toxicity. PMID: 20861805
  25. Data show that pollen grains triggered the production of IL-8, TNF-alpha, IL-6 and strongly upregulated the membrane expression of CD80, CD86, CD83, HLA-DR and caused only a slight increase in the expression of CD40. PMID: 20118277
  26. Data show high expression of CD86 and CD11C, moderate expression of CD1a and CD123, low levels of CD83 on dendritic cells after induction by GM-CSF and IL-4. PMID: 19257981
  27. the soluble extracellular CD83 domain inhibits DC-mediated T-cell proliferation, representing the first report describing a functional role for CD83. PMID: 12072358
  28. cloning and characterization of the promoter region of the human CD83 gene PMID: 12182451
  29. Increased expression of DC-SIGN+IL-12+IL-18+ and CD83+IL-12-IL-18- dendritic cell populations in the colonic mucosa of patients with Crohn's disease PMID: 12594843
  30. induction of the CD83 promoter by LMP1 of Epstein-barr virus is mediated by the activation of NF-kappaB signal pathway in B cells PMID: 12857898
  31. 20% of chronic lymphocytic leukemia & 5/7 mantle-cell lymphoma patients have significantly elevated levels of soluble CD83. sCD83 may have an immunoregulatory role in vivo & functional significance in hematological malignancies, like CLL and MCL. PMID: 14687618
  32. infected mature monocyte-derived dendritic cells lose surface CD83 while maintaining intracellular protein expression in cytomegalovirus infection. PMID: 14962896
  33. monocytes, macrophages and immature DCs contain preformed intracellular CD83, and its rapid surface expression upon activation is post-translationally regulated in a process involving glycosylation PMID: 15320871
  34. combined treatment of phosphatidic acid and tumor necrosis factor-alpha induce expression of CD83 in KG1 cells. PMID: 15454113
  35. analysis of monomeric and dimeric isoforms of CD83 PMID: 15721284
  36. Putative soluble forms of CD83 proteins are characterized by a partial deletion of the extracellular and transmembrane domains; the smallest CD83 splice product shows a strong inhibitory effect on T cell proliferation in mixed leukocyte reactions. PMID: 15905506
  37. Results suggest the importance of tumor-infiltrating CD83(+) dendritic cells as a useful prognostic factor for patients with gallbladder carcinoma. PMID: 16012714
  38. The mature dentritic cells express CD83 and high CD40/80/86, whereas the immature cells express CD1a and low CD40/80/86 PMID: 17197902
  39. HSV-1 induces CD83 degradation in mature dendritic cells with immediate-early kinetics via the cellular proteasome PMID: 17428858
  40. The abundance of CD83+ plasmacytoid dendritic cells (DCs) in perivascular areas and the overexpression of CCL19 and CCL21 in perivascular cellular foci suggest plasmacytoid DCs are central to the muscle inflammation in juvenile dermatomyositis. PMID: 17469160
  41. CD83 antigen was identified as a useful tumor marker for the diagnosis of pediatric large cell lymphoma. PMID: 17535098
  42. mRNA can be measured by real-time polymerase chain reaction to determine removal of dendritic cells in whole blood PMID: 17561858
  43. membrane expression of the dendritic cell maturation marker CD83 on tumor cells from lung cancer patients PMID: 17628801
  44. CD83 gene polymorphisms increase susceptibility to human invasive cervical cancer PMID: 18056445
  45. In rheumatoid arthritis patients, the number of CD304(+) plasmacytoid DCs (pDCs) exceeded that of CD1c(+) myeloid DCs (mDCs), with the majority of infiltrating DCs being CD83(-) or DC-LAMP(-). PMID: 18292234
  46. Data suggest that in systemic lupus erythematosus, the increased number of plasmacytoid dendritic cells (DCs) supports a pathogenic role for these cells, and decreased myeloid DC and CD83 expression may explain susceptibility to infections. PMID: 18625638
  47. GM-CSF can both synergize with TNFalpha in the case of expression of IL1-RA and antagonize in the case of CD83. PMID: 18755511
  48. The CK2 alpha' phosphorylates APRIL and therefore is responsible for the regulation of the nucleocytoplasmic translocation of CD83 mRNA. PMID: 19130553
  49. sCD83 release may play a regulatory role in CLL progression. PMID: 19195701
  50. Overexpression of CD83 in transgenic mice suppresses the humoral response to both T cell-independent and T-cell dependent model antigens in a dose-dependent manner. PMID: 19234177

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.
Database Links

HGNC: 1703

OMIM: 604534

KEGG: hsa:9308

STRING: 9606.ENSP00000368450

UniGene: Hs.595133

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1