Recombinant Human Calcium-binding mitochondrial carrier protein Aralar2 (SLC25A13)

Code CSB-CF892444HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SLC25A13
Uniprot No.
Alternative Names
SLC25A13; ARALAR2; Calcium-binding mitochondrial carrier protein Aralar2; Citrin; Mitochondrial aspartate glutamate carrier 2; Solute carrier family 25 member 13
Species
Homo sapiens (Human)
Expression Region
1-675
Target Protein Sequence
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL AGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGT LPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQR STGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFM HKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFF GIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTP ADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTY ELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPL FKPSVSTSKAIGGGP
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mitochondrial and calcium-binding carrier that catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. May have a function in the urea cycle.
Gene References into Functions
  1. There was a correlation between SLC25A13 gene mutations distribution and the GGT level in infants with neonatal intrahepatic cholestasis caused by citrin deficiency PMID: 28516797
  2. All neonates have harbored mutations of the solute carrier family 25, member 13 protein (SLC25A13) gene, suggesting the SLC25A13 gene probably underlie the neonatal intrahepatic cholestasis caused by citrin deficiency (NICCD). PMID: 29419856
  3. These findings enriched the SLC25A13 mutation spectrum and brought new insights into the geographic distribution of the variations and genotypes, providing reliable evidences for Neonatal intrahepatic cholestasis caused by citrin deficiency definite diagnosis and for the determination of relevant molecular targets in different Chinese areas. PMID: 27405544
  4. Upregulation of GLUD1 and SLC25A13 was associated with tumor aggressiveness and poorer prognosis in colorectal cancer patients. PMID: 27924922
  5. The remaining five patients were diagnosed with neonatal intrahepatic cholestasis due to citrin deficiency, and have respectively carried mutations of the SLC25A13 gene including [c.851-854delGTAT+c.851-854delGTAT], [c.851-854delGTAT+IVS6+5G>A], [c.851-854delGTAT+IVS16ins3kb], [c.851-854delGTAT+IVS6-11A>G] and [c.851-854delGTAT+c.1638-1660dup23] PMID: 28981931
  6. The features of AGC1 structure and function in physiology and pathology, regulation by calcium, and dependency on mitochondrial membrane potential are reviewed. Review. PMID: 27132995
  7. the present study reported on clinical and molecular investigations of an infant with NICCD, who was confirmed to be a compound heterozygote of the c.851_854del4 mutation and a novel large deletion c.1019_1177+893del in the SLC25A13 gene. PMID: 27779681
  8. The large deletion enriched the SLC25A13 mutation spectrum, and its identification supported the concept that cDNA cloning analysis, along with other molecular tools such as semiquantitative PCR, could provide valuable clues, facilitating the identification of obscure SLC25A13 deletions. PMID: 27127784
  9. Data indicate that the patient was a compound heterozygote carrying c.851_854delGTAT and IVS16ins3kb mutations of the mitochondrial carrier citrin protein (SLC25A13) gene, which were respectively inherited from his mother and father. PMID: 27577219
  10. Structure of the calcium bound and calcium free N- and C-terminal domains is described, elucidating the mechanism of calcium regulation. PMID: 25410934
  11. This study aims to screen for five prevalent SLC25A13 mutations, to calculate the mutation carrier rate in Guangdong. PMID: 25110155
  12. we reviewed the English literature on mutations in the SLC25A13 gene, and its genotype-phenotype correlations to provide valuable insights into the molecular genetic background of citrullinemia--{REVIEW} PMID: 24508627
  13. Mutation screening of the SLC25A13 gene revealed the compound heterozygous mutations c.1081C>T (p.R361*) and c.74C>A (p. A25E) which confirmed the diagnosis of NICCD. The nonsense mutation c.1081C>T (p.R361*) is novel. PMID: 25365849
  14. Point mutation of ASS1, ASL and SLC25A13 is associated with citrullinemia. PMID: 24927999
  15. Identification of novel SLC25A13 gene mutations in East Asian patients with citrin deficiency. PMID: 24069319
  16. Analysis of the SLC25A13 gene sequence. PMID: 23053473
  17. Report frequency SLC25A13 mutations in the Thai population and estimate prevalence of citrin deficiency. PMID: 24282362
  18. The SLC25A13 mutation spectra among the three regions of China were different, providing a basis for the improvement of diagnostic strategies and interpretation of genetic diagnosis. PMID: 23901231
  19. The first two cases of NICCD are described in infants from the UK, one of Caucasian and one of Pakistani origin. PMID: 19517266
  20. Compares and contrasts all the known human SLC25A* genes and includes functional information. PMID: 23266187
  21. The objectives were to study the prevalence of neonatal intrahepatic cholestasis caused by citrin deficiency (NICCD) in Thai infants with idiopathic cholestasis, mutation spectrum of SLC25A13 in Thai NICCD, and comparison of clinical manifestations and blood chemistry between NICCD and non-NICCD infants. PMID: 23067347
  22. uncovered the marked transcript diversity of SLC25A13 gene in human PBLs, and suggested that cDNA cloning analysis of this gene in human PBLs might be a feasible tool for CD molecular diagno PMID: 23022256
  23. Mutations in SLC25A13 are associated with citrin deficiency. PMID: 22277121
  24. In 171 suspected patients, seven neonatal intrahepatic cholestasis caused by citrin deficiency patients were detected by HRM. PMID: 22487826
  25. Functional studies, carried out on the recombinant mutant protein containing glutamate at position 437, demonstrated that neonatal intrahepatic cholestasis caused by citrin deficiency is caused by a reduced transport activity of SLC25A13 PMID: 21914561
  26. Case Report: suggest that the administration of arginine and sodium pyruvate with low-carbohydrate meals may be an effective therapy in patients with citrin deficiency. PMID: 18958581
  27. individuals with non-viral HCC were more likely to possess SLC25A13 gene mutations compared to healthy subjects PMID: 21470889
  28. this study expanded the genotypic and phenotypic spectrum of citrin deficiency. PMID: 21424115
  29. SLC25A13 gene mutations play an important role in Chinese infants with intrahepatic cholestasis and various forms of aminoacidemia; 851del4 and 1638ins23 are the most common mutation types PMID: 20927635
  30. Seven genetic variations of SLC25A13, termed as 851del4, 1638ins23, IVS16ins3kb, IVS6+5G>A, c.775C>T (p.Q259X), c.1505C>T (p.P502L) and c.1311C>T (p.C437C), were identified PMID: 21507300
  31. The SLC25A13 mutations may not be a major contributor to the pathogenesis of hepatocellular carcinoma in Taiwan. PMID: 21134364
  32. MDR analysis provided evidence of interaction between the genes for ASS1 and SLC25A13 on the risk of CL/P. PMID: 20739017
  33. Four hundred infants with unexplained intrahepatic cholestasis from 18 China were studied for detecting SLC25A13 gene mutation 851del4. Eight homozygous and 30 heterozygous mutations were detected in 46 mutant alleles with a 851del4 mutation rate of 5.8%. PMID: 20458766
  34. We report three unrelated Malay children with genetically confirmed neonatal intrahepatic cholestatic caused by citrin deficiency characterised by an insertion mutation IVS16ins3kb in SLC25A13 gene PMID: 20614727
  35. SLC25A13 gene mutations exist in Chinese infants with intrahepatic cholestasis and abnormal blood amino acids. PMID: 18578996
  36. The historical aspects of citrin and citrin deficiency, characteristic food preference and food aversion of citrin-deficient subjects, and carbohydrate toxicity in relation to ureogenesis, is described. PMID: 20233664
  37. The 851del4, 1638ins23 and IVS6+5G>A mutations are the hot-spot mutations in Chinese patients with neonatal intrahepatic cholestasis caused by citrin deficiency. PMID: 20376801
  38. genetic screening of mutations in early and late onset patients with citrin deficiency and in the Japanese population: identification of two novel mutations and establishment of multiple DNA diagnosis methods for nine mutations PMID: 11793471
  39. Adult-onset type II citrullinemia is caused by mutations of the SLC25A13 gene PMID: 12111366
  40. Citrullinemia is a metabolic disorder characterized by elevated plasma concentrations of citrulline and ammonia. Adult-onset citrullinemia (type II, CTLN2) has been attributed to citrin deficiency caused by mutations in the SLC25A13 gene. PMID: 17000460
  41. Analysis of citrin protein in peripheral blood lymphocytes is useful to diagnose citrin deficiency in patients without known mutations or hypercitrullinemia. PMID: 17092749
  42. This report describes the clinical characteristics, biochemical findings and molecular analysis of the SLC25A13 gene of patients with citrin deficiency in Korea. PMID: 17982687
  43. report 13 novel SLC25A13 mutations (one insertion, two deletion, three splice site, two nonsense, and five missense) in patients with citrin deficiency from Japan, Israel, UK, and Czech Republic PMID: 18392553
  44. Patients presenting with non-alcoholic fatty liver unrelated to obesity and metabolic syndrome might have citrin deficiency, caused by SLC25A13 gene mutations. PMID: 18620775
  45. 5 novel mutations were found in SLC25A13 from three unrelated French-Canadian Citrin deficiency patients. PMID: 19036621
  46. Results of this study showed, even during the silent period, sustained hypercitrullinemia, hypercholesterolemia, and augmented oxidative stress in children with citrin deficiency. PMID: 19232506
  47. 851del4/1638ins23 mutations in a Chinese adult onset type II citrullinaemia patient PMID: 11432966

Show More

Hide All

Involvement in disease
Citrullinemia 2 (CTLN2); Cholestasis, neonatal intrahepatic, caused by citrin deficiency (NICCD)
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity
High levels in liver and low levels in kidney, pancreas, placenta, heart and brain.
Database Links

HGNC: 10983

OMIM: 603471

KEGG: hsa:10165

STRING: 9606.ENSP00000400101

UniGene: Hs.489190

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1