Recombinant Human Ceramide synthase 1(CERS1)

Code CSB-CF012761HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P27544
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPEL LLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLL FGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVML LHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAA DLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFL YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Source in vitro E.coli expression system
Gene Names CERS1
Protein Names Recommended name: Ceramide synthase 1 Short name= CerS1 Alternative name(s): LAG1 longevity assurance homolog 1 Longevity assurance gene 1 protein homolog 1 Protein UOG-1
Expression Region 1-350
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner (By similarity).
Involvement in disease Epilepsy, progressive myoclonic 8 (EPM8)
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Isoform 1: Endoplasmic reticulum membrane, Multi-pass membrane protein, Golgi apparatus membrane, Multi-pass membrane protein
Database Links

HGNC: 14253

OMIM: 606919

KEGG: hsa:10715

STRING: 9606.ENSP00000402697

UniGene: Hs.412355

Related Products

CERS1 Antibodies

CERS1 Antibodies for Homo sapiens (Human)

CERS1 Antibodies for Human

CERS1 Proteins

CERS1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.