Recombinant Human Ceramide synthase 2 (CERS2)

Code CSB-CF839326HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CERS2
Uniprot No.
Alternative Names
CERS2; LASS2; TMSG1; Ceramide synthase 2; CerS2; LAG1 longevity assurance homolog 2; SP260; Sphingosine N-acyltransferase CERS2; Tumor metastasis-suppressor gene 1 protein; Very-long-chain ceramide synthase CERS2
Species
Homo sapiens (Human)
Expression Region
1-380
Target Protein Sequence
MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYV ATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHD SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF GYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGA KSRPLANGHPILNNNHRKND
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ceramide synthase that catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward very-long-chain fatty acyl-CoA (chain length C22-C27). N-acylates sphinganine and sphingosine bases to form dihydroceramides and ceramides in de novo synthesis and salvage pathways, respectively. Plays a non-redundant role in the synthesis of ceramides with very-long-chain fatty acids in kidney, liver and brain. Regulates the abundance of myelin-specific sphingolipids galactosylceramide and sulfatide that affects myelin sheath architecture and motor neuron functions.
Gene References into Functions
  1. As potential molecular markers for bladder carcinoma, both TWIST1 and LASS2 transcripts seem to play role during the tumorigenesis and development of bladder cancer. PMID: 30213291
  2. Results show that silencing of ATP6V0C in highly metastatic prostate cancer (PC) cell lines, inhibited V-ATPase activity, which coincided with the inhibition of cell migration and invasion in vitro, as well as a marked decrease in the expression of LASS2/TMSG1 probably through positive feedback. PMID: 29138865
  3. CerS2-knockdown via CRISPR-Cas9 technology in cultured colon epithelial cells impaired barrier function. PMID: 28699686
  4. Low expression of LASS2 and TGFB1 contributes to the aggressiveness and poor prognosis of hepatocellular carcinoma, and may represent a novel prognostic biomarker for hepatocellular carcinoma patients. PMID: 27581744
  5. ASGR1 can inhibit the activity of V-ATPase by interacting with LASS2, thereby suppressing the metastatic potential of hepatoma cells. PMID: 27241665
  6. These results suggest that the phosphorylation of ceramide synthases may be a key regulatory point in the control of the distribution and levels of sphingolipids of various acyl-chain lengths. PMID: 26887952
  7. Data show that 1-acylglycerol-3-phosphate O-acyltransferase 9 (AGPAT9) inhibit cell growth by regulating expression of KLF4/LASS2/V-ATPase proteins in breast cancer. PMID: 26110566
  8. these results indicate that miR-9 upregulation might be associated with malignant phenotype of bladder cancer. miR-9 promotes chemoresistance of bladder cancer cells by target LASS2. PMID: 26150338
  9. Data show that CERS2 expression was markedly different between various breast cancer cells and inversely correlated with cell invasion. PMID: 25213553
  10. silencing of TMSG1 increased V-ATPase activity, decreased extracellular pH and in turn the activation of secreted MMP-2, which ultimately promoted metastasis capacity of breast cancer cell. PMID: 25973015
  11. Results confirmed that TMSG1 is a potential metastasis suppressor gene, and suggested that the mechanism involved the induction of apoptosis and inhibition of cell proliferation via a caspase-dependent mitochondrial pathway. PMID: 25735224
  12. the vacuolar ATPase (V-ATPase) activity and extracellular hydrogen ion concentration were significantly decreased and the activity of secreted matrix metalloproteinase-2 (MMP-2) was downregulated in MCF-7 cells overexpressing LASS2/TMSG1 PMID: 25501280
  13. the inhibitory effect of the LASS2 on growth, invasion and metastasis of prostate cancer cells PMID: 24453046
  14. Co-expression of CerS2 with CerS4/CerS6 reversed the inhibitory effect of long chain ceramides on cell proliferation and the induction of apoptosis. we detected no effect on cell proliferation. PMID: 23538298
  15. expression and role of ceramide synthase-2 in the lung PMID: 23690971
  16. results contribute to the conclusion that LASS2/TMSG1 could regulate V-ATPase activity and intracellular pH through the direct interaction of its homeodomain and the C subunit of V-ATPase PMID: 22991218
  17. LASS2 expression may be correlated with the development and progression of human bladder carcinoma PMID: 21755371
  18. LASS2 is involved in chemotherapeutic outcomes and low LASS2 expression may predict chemoresistance. PMID: 22580606
  19. Silencing of LASS2 can promote invasion of prostate cancer cells in vitro through the increase of V-ATPase activity, extracellular hydrogen ion concentration and activation of secreted MMP-2. PMID: 22178826
  20. There is a nucleolar localization signal within TMSG-1. PMID: 22336162
  21. silencing of LASS2/TMSG1 can promote invasion of prostate cancer cell in vitro through increase of V-ATPase activity which accelerated tumor's invasion and metastasis, indicating that LASS2/TMSG1 is a novel tumor metastasis suppressor gene PMID: 22573553
  22. Interaction of KLF6 and Sp1, together with their binding of elements in exon 1 are critical events in initiation of transcription of the tmsg-1 gene. PMID: 21928351
  23. KLF6 and Sp1 may participate in the inducible transcriptional regulation of TMSG-1 in prostate carcinoma cells. PMID: 22169644
  24. TMSG-1 overexpression caused strong inhibition of proliferation and decreased clonogenicity of MDA-MB-231 cells, and promoted cell apoptosis. PMID: 18194600
  25. Overexpression of CerS2 resulted in partial protection from ionizing radiation-induced apoptosis PMID: 20406683
  26. CerS2 and CerS6 mRNA was significantly elevated in breast cancer tissue compared to paired normal tissue, with approximately half of the individuals showing elevated CerS2 and CerS6 mRNA. PMID: 19912991
  27. activity of CerS2 can be regulated by another bioactive sphingolipid, sphingosine 1-phosphate PMID: 18165233
  28. CerS2 down-regulation had a broad effect on ceramide homoeostasis, not just on very-long-chain ceramides. PMID: 19728861

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in kidney, liver, brain, heart, placenta and lung.
Database Links

HGNC: 14076

OMIM: 606920

KEGG: hsa:29956

STRING: 9606.ENSP00000271688

UniGene: Hs.744017

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1