Recombinant Human Cortexin-1(CTXN1)

Code CSB-CF006210HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P60606
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRM PASSWTDHKEALERGQFDYALV
Source in vitro E.coli expression system
Gene Names CTXN1
Protein Names Recommended name: Cortexin-1
Expression Region 1-82
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May mediate extracellular or intracellular signaling of cortical neurons during forebrain development.
Subcellular Location Membrane, Single-pass membrane protein
Protein Families Cortexin family
Database Links

HGNC: 31108

OMIM: 600135

KEGG: hsa:404217

UniGene: Hs.657978

Related Products

CTXN1 Proteins

CTXN1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.