Recombinant Human Diacylglycerol O-acyltransferase 2-like protein 6(DGAT2L6)

Code CSB-CF757941HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6ZPD8
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MAFFSRLNLQEGLQTFFVLQWIPVYIFLGAIPILLIPYFLLFSKFWPLAVLSLAWLTYDW NTHSQGGRRSAWVRNWTLWKYFRNYFPVKLVKTHDLSPKHNYIIANHPHGILSFGVFINF ATEATGIARIFPSITPFVGTLERIFWIPIVREYVMSMGVCPVSSSALKYLLTQKGSGNAV VIVVGGAAEALLCRPGASTLFLKQRKGFVKMALQTGAYLVPSYSFGENEVFNQETFPEGT WLRLFQKTFQDTFKKILGLNFCTFHGRGFTRGSWGFLPFNRPITTVVGEPLPIPRIKRPN QKTVDKYHALYISALRKLFDQHKVEYGLPETQELTIT
Source in vitro E.coli expression system
Gene Names DGAT2L6
Protein Names Recommended name: Diacylglycerol O-acyltransferase 2-like protein 6 EC= 2.3.1.- Alternative name(s): Diacylglycerol O-acyltransferase candidate 3 Short name= hDC3
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable acyltransferase uses fatty acyl-CoA as substrate (By similarity). Has no wax synthase activity to produce wax esters.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Diacylglycerol acyltransferase family
Tissue Specificity Expressed in all tissues tested except pancreas.
Database Links

HGNC: 23250

OMIM: 300926

KEGG: hsa:347516

STRING: 9606.ENSP00000328036

UniGene: Hs.454355

Related Products

DGAT2L6 Antibodies

DGAT2L6 Antibodies for Homo sapiens (Human)

DGAT2L6 Proteins

DGAT2L6 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.