Recombinant Human E3 ubiquitin-protein ligase MARCH2 (MARCH2)-VLPs

Code CSB-MP878948HU
MSDS
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MARCH2
Uniprot No.
Research Area
Cell Biology
Alternative Names
MARCHF2; MARCH2; RNF172; HSPC240; E3 ubiquitin-protein ligase MARCHF2; Membrane-associated RING finger protein 2; Membrane-associated RING-CH protein II; MARCH-II; RING finger protein 172; RING-type E3 ubiquitin transferase MARCHF2
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-246aa
Target Protein Sequence
MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6.
Gene References into Functions
  1. In this study, the authors found the expression of MARCH2 to be upregulated upon HIV-1 infection. MARCH2 inhibits the production and infection of HIV-1 through ligase activity-dependent envelope protein degradation and/or intracellular retention. PMID: 29573664
  2. MARCH2 has a role in regulating autophagy by promoting CFTR ubiquitination and degradation and PIK3CA-AKT-MTOR signaling PMID: 27308891
  3. The MARCH2 E3 ligase activity regulates cell surface beta(2)AR expression and, consequently, its signaling. PMID: 23166351
  4. Depletion of MARCH-II by small interfering RNA perturbed the trans-Golgi network (TGN) localization of syntaxin 6 and TGN38/46 PMID: 15689499
  5. MARCH2 is co-localized with DLG1 at sites of cell-cell contact. PMID: 17980554

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Broadly expressed.
Database Links

HGNC: 28038

OMIM: 613332

KEGG: hsa:51257

STRING: 9606.ENSP00000215555

UniGene: Hs.631861

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*