Product Details

Target Names

MARCH2

Uniprot No.

Q9P0N8

Research Area

Cell Biology

Alternative Names

MARCHF2; MARCH2; RNF172; HSPC240; E3 ubiquitin-protein ligase MARCHF2; Membrane-associated RING finger protein 2; Membrane-associated RING-CH protein II; MARCH-II; RING finger protein 172; RING-type E3 ubiquitin transferase MARCHF2

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-246aa

Target Protein Sequence

MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Tag Info

C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.

Form

Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.

Buffer

Lyophilized from PBS, 6% Trehalose, pH 7.4

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.

Datasheet & COA

Please contact us to get it.

Target Background

Function

E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6.

Gene References into Functions

In this study, the authors found the expression of MARCH2 to be upregulated upon HIV-1 infection. MARCH2 inhibits the production and infection of HIV-1 through ligase activity-dependent envelope protein degradation and/or intracellular retention. PMID: 29573664
MARCH2 has a role in regulating autophagy by promoting CFTR ubiquitination and degradation and PIK3CA-AKT-MTOR signaling PMID: 27308891
The MARCH2 E3 ligase activity regulates cell surface beta(2)AR expression and, consequently, its signaling. PMID: 23166351
Depletion of MARCH-II by small interfering RNA perturbed the trans-Golgi network (TGN) localization of syntaxin 6 and TGN38/46 PMID: 15689499
MARCH2 is co-localized with DLG1 at sites of cell-cell contact. PMID: 17980554

Hide All

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.

Tissue Specificity

Broadly expressed.

Database Links

HGNC: 28038

OMIM: 613332

KEGG: hsa:51257

STRING: 9606.ENSP00000215555

UniGene: Hs.631861