Recombinant Human E3 ubiquitin-protein ligase MARCH5 (MARCH5)

Code CSB-CF889137HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MARCH5
Uniprot No.
Alternative Names
MARCHF5; MARCH5; RNF153; E3 ubiquitin-protein ligase MARCHF5; Membrane-associated RING finger protein 5; Membrane-associated RING-CH protein V; MARCH-V; Mitochondrial ubiquitin ligase; MITOL; RING finger protein 153; RING-type E3 ubiquitin transferase MARCHF5
Species
Homo sapiens (Human)
Expression Region
1-278
Target Protein Sequence
MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNST ARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVT VMQVVGHKEGLDVMERADPLFLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILN SIFPGIGCPVPRIPAEANPLADHVSATRILCGALVFPTIATIVGKLMFSSVNSNLQRTIL GGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQEEA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mitochondrial E3 ubiquitin-protein ligase that plays a crucial role in the control of mitochondrial morphology by acting as a positive regulator of mitochondrial fission. May play a role in the prevention of cell senescence acting as a regulator of mitochondrial quality control. Promotes ubiquitination of FIS1, DNM1L and MFN1.
Gene References into Functions
  1. the results of this study identified MARCH5 as a candidate oncogene in ovarian cancer and a potential target for ovarian cancer therapy. PMID: 27875077
  2. MARCH5 directly interacts with FUNDC1 to mediate its ubiquitylation at lysine 119 for subsequent degradation. PMID: 28104734
  3. These findings and data showing MARCH5-dependent degradation of MiD49 upon stress support the possibility that MARCH5 regulation of MiD49 is a novel mechanism controlling mitochondrial fission and, consequently, the cellular response to stress. PMID: 26564796
  4. Self-clearance mechanism of mitochondrial ligase MARCH5 contributes to mitochondria quality control.MARCH5 is regulated by auto-ubiquitination. PMID: 26476016
  5. MARCH5 binds MAVS only during viral stimulation when MAVS forms aggregates, and these interactions require the RING domain of MARCH5 and the CARD domain of MAVS. PMID: 26246171
  6. Our results indicate that HDAC6 is a critical regulator of MFN2 degradation by MARCH5, thus protecting mitochondrial connectivity from hypoxic stress. PMID: 26210454
  7. A fine balance of Mfn1 levels is maintained by MARCH5-mediated quality control on acetylated Mfn1. PMID: 24722297
  8. MITOL regulates ER tethering to mitochondria by activating Mfn2 via K192 ubiquitination. PMID: 23727017
  9. balance between LC1 activation by S-nitrosylation and down-regulation by MITOL is critical for neuronal cell survival PMID: 22308378
  10. MARCH5 is an authentic E3 ubiquitin ligase and catalyzes K63-linked polyubiquitination of TANK. MARCH5 modulates TLR7 signaling via releasing the inhibitory action of TANK toward TRAF6. PMID: 21625535
  11. study found that MITOL interacts with and ubiquitinates DeltaNAT-3Q71, a pathogenic ataxin-3 mutant, in mitochondria and attenuates its toxicity PMID: 20851218
  12. lack of MARCH5 results in mitochondrial elongation, which promotes cellular senescence by blocking Drp1 activity and/or promoting accumulation of Mfn1 at the mitochondria PMID: 20103533
  13. Results indicate that MITOL plays a protective role against mitochondrial dysfunction caused by the mitochondrial accumulation of mSOD1 via the ubiquitin-proteasome pathway. PMID: 19741096
  14. A novel mitochondrial ubiquitin ligase, designated MITOL, which is localized in the mitochondrial outer membrane, plays a critical role in mitochondrial dynamics through the control of mitochondrial fission proteins. PMID: 16874301
  15. MARCH-V has a crucial role in the control of mitochondrial morphology by regulating MFN2 and Drp1 activities. PMID: 16936636
  16. MARCH5 is required for DRP1-dependent mitochondrial division. PMID: 17606867

Show More

Hide All

Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brain, heart, liver, lung, spleen, stomach, testis, skeletal and muscle.
Database Links

HGNC: 26025

OMIM: 610637

KEGG: hsa:54708

STRING: 9606.ENSP00000351813

UniGene: Hs.573490

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X