Recombinant Human E3 ubiquitin-protein ligase MARCH8 (41341)

Code CSB-CF722561HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MARCH8
Uniprot No.
Alternative Names
MARCHF8; MARCH8; MIR; RNF178; E3 ubiquitin-protein ligase MARCHF8; Cellular modulator of immune recognition; c-MIR; Membrane-associated RING finger protein 8; Membrane-associated RING-CH protein VIII; MARCH-VIII; RING finger protein 178; RING-type E3 ubiquitin transferase MARCHF8
Species
Homo sapiens (Human)
Expression Region
1-291
Target Protein Sequence
MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASA PAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDT RCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRT AEEIKQGQATGILEWPFWTKLVVVAIGFTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQN CPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
E3 ubiquitin-protein ligase that mediates ubiquitination of CD86 and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. May also promote ubiquitination and endocytosis of TFRC and FAS.
Gene References into Functions
  1. Knockdown of MARCH8 inactivated the PI3K and ss-catenin stat3 signaling pathways by changing protein expression levels or the phosphorylation of related proteins and inhibited migration and invasion of MKN-45 and AGS cells. PMID: 30138931
  2. Two additional regulators of BST2 constitutive ubiquitylation and sorting to the lysosomes: the E3 ubiquitin ligases NEDD4 and MARCH8, are reported. PMID: 28320822
  3. Salmonella typhimurium SteD caused MARCH8-dependent ubiquitination and depletion of surface-localized mature MHC class II antigens. PMID: 27832589
  4. YopJ mediates Ser- and Lys-acetylation and affects auto-ubiquitination of ubiquitin ligase MARCH8 in human cells. PMID: 28103160
  5. Kaposi's sarcoma-associated herpesvirus RTA not only downregulated HLA-DRalpha at the protein level through direct binding and degradation through the proteasome pathway but also indirectly downregulated the protein level of HLA-DRalpha by enhancing the expression of MARCH8, a member of the membrane-associated RING-CH (MARCH) proteins. PMID: 27356905
  6. MARCH8 is highly expressed in terminally differentiated myeloid cells, and that it is a potent antiviral protein that targets viral envelope glycoproteins and reduces their incorporation into virions. PMID: 26523972
  7. MARCH 8 mediates the ubiquitination and lysosomal degradation of the transferrin receptor. PMID: 23606747
  8. MARCH8 protein localizes in lysosomes in HeLa cells PMID: 21752829
  9. endogenous MARCH-8 regulates the steady-state cell surface expression of TRAIL-R1. PMID: 23300075
  10. MARCH8-mediated polyubiquitination and degradation of IL1RAP is an important mechanism for negative regulation of IL-1beta-induced signaling pathways. PMID: 22904187
  11. MARCH8 expression led to direct ubiquitination of CD98 and routing of CD98 to late endosomes/lysosomes PMID: 21757542
  12. Membrane-Associated RING-CH proteins MARCH VIII and MARCH IV associate with Bap31 and target CD81 and CD44 to lysosomes PMID: 21151997
  13. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  14. c-MIR induced specific down-regulation of B7-2 surface expression through ubiquitination, rapid endocytosis, and lysosomal degradation PMID: 12582153
  15. Of the classifier's 11 informative genes, expression of MIR and WDR40 showed statistically significant increases for both Grade 1B and Grade >or=3A rejection. PMID: 18096478
  16. Observational study of gene-disease association. (HuGE Navigator) PMID: 16385451

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Broadly expressed. Present in immature dendritic cells (at protein level).
Database Links

HGNC: 23356

OMIM: 613335

KEGG: hsa:220972

STRING: 9606.ENSP00000317087

UniGene: Hs.499489

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1