Recombinant Human EGF-like module-containing mucin-like hormone receptor-like 3(EMR3)

Code CSB-CF861168HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9BY15
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence SSFAVLMALTSQEEDPVLTVITYVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLC LFLAHLLFLVGIDRTEPKVLCSIIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSS INRLMKWIMFPVGYGVPAVTVAISAASWPHLYGTADRCWLHLDQGFMWSFLGPVCAIFSA NLVLFILVFWILKRKLSSLNSEVSTIQNTRMLAFKATAQLFILGCTWCLGLLQVGPAAQV MAYLFTIINSLQGFFIFLVYCLLSQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKP SEGDVFPGQVKRKY
Source in vitro E.coli expression system
Gene Names ADGRE3
Protein Names Recommended name: EGF-like module-containing mucin-like hormone receptor-like 3 Alternative name(s): EGF-like module receptor 3 Cleaved into the following 2 chains: 1. EGF-like module-containing mucin-like hormone receptor-like 3 subunit alpha
Expression Region 339-652
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor that may play a role myeloid-myeloid interactions during immune and inflammatory responses. A ligand for the soluble form of this receptor is present at the surface of monocytes-derived macrophages and activated neutrophils.
Subcellular Location Cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted
Protein Families G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily
Tissue Specificity Displays a predominantly leukocyte-restricted expression, with highest levels in neutrophils, monocytes and macrophages.
Database Links

HGNC: 23647

OMIM: 606101

KEGG: hsa:84658

STRING: 9606.ENSP00000253673

UniGene: Hs.658712

Related Products

ADGRE3 Antibodies

ADGRE3 Antibodies for Homo sapiens (Human)

ADGRE3 Proteins

ADGRE3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.