Recombinant Human Elongation of very long chain fatty acids protein 2 (ELOVL2)

Code CSB-CF889139HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ELOVL2
Uniprot No.
Alternative Names
ELOVL2; ELG3; SSC2; Elongation of very long chain fatty acids protein 2; 3-keto acyl-CoA synthase ELOVL2; ELOVL fatty acid elongase 2; ELOVL FA elongase 2; Very long chain 3-ketoacyl-CoA synthase 2; Very long chain 3-oxoacyl-CoA synthase 2
Species
Homo sapiens (Human)
Expression Region
1-296
Target Protein Sequence
MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRP ALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYY FSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIH ILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSS YMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that catalyzes the synthesis of polyunsaturated very long chain fatty acid (C20- and C22-PUFA), acting specifically toward polyunsaturated acyl-CoA with the higher activity toward C20:4(n-6) acyl-CoA. May participate in the production of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.
Gene References into Functions
  1. Results shows that ELOVL2 promoter displays an exceptionally consistent increase in DNA methylation with age in all tissues. PMID: 29848354
  2. ELOVL2 methylation is a marker of cell divisions occurring during human aging PMID: 27672102
  3. common variations not associated with polyunsaturated fatty acid levels in breast milk PMID: 28245901
  4. Estrogen Enhances the Expression of the Polyunsaturated Fatty Acid Elongase Elovl2 via ERalpha in Breast Cancer Cells PMID: 27788154
  5. Polymorphisms in the ELOVL2 gene were not associated with the risk of developing allergic disease PMID: 26633493
  6. results show that the ELOVL2 locus provides a very good source of information about human chronological age based on analysis of blood, including bloodstains, and it may constitute a powerful and reliable predictor in future forensic age estimation models PMID: 25450787
  7. we do not found the association between rs3756593 of ELOVL2 gene and acute coronary syndrome in Chinese Han population PMID: 23555103
  8. Methylation of ELOVL2 gene is a new epigenetic marker of age. PMID: 23061750
  9. rs3756963 in ELOVL2 gene may be associated with paranoid schizophrenia. PMID: 21560298
  10. gene interaction analysis showed that the combined genotype of FADS1 rs174556 (T/T) and ELOVL2 rs3756963 (T/T) was weakly associated with coronary artery disease PMID: 21917437

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
ELO family, ELOVL2 subfamily
Tissue Specificity
Liver and testis.
Database Links

HGNC: 14416

OMIM: 611814

KEGG: hsa:54898

STRING: 9606.ENSP00000346693

UniGene: Hs.656436

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×