Recombinant Human Elongation of very long chain fatty acids protein 6 (ELOVL6)

Code CSB-CF875678HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ELOVL6
Uniprot No.
Alternative Names
ELOVL6; FACE; LCE; Elongation of very long chain fatty acids protein 6; 3-keto acyl-CoA synthase ELOVL6; ELOVL fatty acid elongase 6; ELOVL FA elongase 6; Fatty acid elongase 2; hELO2; Fatty acyl-CoA elongase; Long-chain fatty-acyl elongase; Very long chain 3-ketoacyl-CoA synthase 6; Very long chain 3-oxoacyl-CoA synthase 6
Species
Homo sapiens (Human)
Expression Region
1-265
Target Protein Sequence
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR KPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSK APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY YALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYL SYLVLFCHFFFEAYIGKMRKTTKAE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that elongates fatty acids with 12, 14 and 16 carbons with higher activity toward C16:0 acyl-CoAs. Catalyzes the synthesis of unsaturated C16 long chain fatty acids and, to a lesser extent, C18:0 and those with low desaturation degree. May participate in the production of saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.
Gene References into Functions
  1. Functional screening...revealed ELOVL6 as the main elongation enzyme responsible for acyl chain elongation in lung cancer squamous cell carcinoma cancer cells PMID: 26862848
  2. Ultra-high-throughput fluorescence screening followed by a RapidFire mass spectrometry assay was a suitable strategy for lead discovery against Elovl6. PMID: 27793673
  3. ). In conclusion, we found an interaction between the HLA-Cw6 and LCE genotypes on disease improvement among psoriatic patients treated with anti-TNFs. PMID: 25794162
  4. KAR regulates ELOVL6 via two modes; KAR may induce conformational changes in ELOVL6; conversion of 3-ketoacyl-CoA to 3-hydroxyacyl-CoA by KAR may facilitate release of the product from the ELOVL6-KAR complex. PMID: 25003994
  5. human liver samples from patients with Non-alcoholic steatohepatitis or Non-alcoholic steatohepatitis-related hepatocellular carcinoma showed an elevated expression of the elongase ELOVL6, which is responsible for the elongation of C16 fatty acids. PMID: 24714086
  6. The study indicated that the ELOVL6 gene polymorphism rs12504538 is associated with an increased risk of T2DM, because it causes an increase in insulin resistance. PMID: 23903678
  7. Elovl6 expression is significantly downregulated in human lung with idiopathic pulmonary fibrosis. PMID: 24113622
  8. Elovl6 expression is positively correlated with severity of hepatosteatosis and liver injury in NASH patients. PMID: 22753171
  9. study showed cystic fibrosis cells exhibit increased metabolism along metabolic pathways leading to n-7 and n-9 fatty acids compared with wild-type cells; changes are accompanied by increased expression of Delta5, Delta6 and Delta9 desaturases and elongases 5 and 6 PMID: 21544602
  10. Genetic variations in the ELOVL6 gene were associated with insulin sensitivity in this population-based study. PMID: 21701577
  11. Studies suggest that inhibition of ELOVL6 could be a new therapeutic approach for the treatment of insulin resistance, diabetes, cardiovascular disease, and other metabolic diseases. PMID: 19259639

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
ELO family, ELOVL6 subfamily
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 15829

OMIM: 611546

KEGG: hsa:79071

STRING: 9606.ENSP00000304736

UniGene: Hs.412939

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1