Recombinant Human Ephrin-B1(EFNB1)

Code CSB-CF007465HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P98172
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Source in vitro E.coli expression system
Gene Names EFNB1
Protein Names Recommended name: Ephrin-B1 Alternative name(s): EFL-3 ELK ligand Short name= ELK-L EPH-related receptor tyrosine kinase ligand 2 Short name= LERK-2
Expression Region 28-346
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds to the receptor tyrosine kinases EPHB1 and EPHA1. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons (By similarity).
Involvement in disease Craniofrontonasal syndrome (CFNS)
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Ephrin family
Tissue Specificity Heart, placenta, lung, liver, skeletal muscle, kidney, pancreas.
Database Links

HGNC: 3226

OMIM: 300035

KEGG: hsa:1947

STRING: 9606.ENSP00000204961

UniGene: Hs.144700

Related Products

EFNB1 Antibodies

EFNB1 Antibodies for Homo sapiens (Human)

EFNB1 Antibodies for Human

EFNB1 Proteins

EFNB1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.